KEGG   Mus musculus (house mouse): 68971
Entry
68971             CDS       T01002                                 
Symbol
Tamm41, 1500001M20Rik, TAM41
Name
(RefSeq) TAM41 mitochondrial translocator assembly and maintenance homolog
  KO
K17807  mitochondrial translocator assembly and maintenance protein 41
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    68971 (Tamm41)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    68971 (Tamm41)
SSDB
Motif
Pfam: Tam41_Mmp37
Other DBs
NCBI-GeneID: 68971
NCBI-ProteinID: NP_081170
MGI: 1916221
Ensembl: ENSMUSG00000030316
UniProt: G5E881
Position
6:complement(114981342..115014890)
AA seq 337 aa
MALQALHSSGVGLRRILAHFPEDLSLAFAYGSAVYRQAGPSAHQENPMLDLVFTVDDPVA
WHAMNLKKNWSHYSFLKLLGPRIISSIQNNYGAGVYFNPLIRCDGKLIKYGVISTGTLIE
DLLNWNNLYIAGRLQKPVKIVSMNENMALRAALDKNLRSAVTTACLMLPESFSEEDLFIE
IAGLSYSGDFRMVIGEEKSKVLNIVKPNVGHFRELYESILQKDPQVVYKMHQGQLEIDKS
PEGQFTQLMTLPRTLQQQINHIMDPPGRNRDVEETLLQVAQDPDCGDVVRLAISSIVRPS
SIRQSTKGLFTAGMKKSVIYSSRKLNKMWKGWMRKAS
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcgctgcaggcgctgcacagctcgggcgtgggcctgcgcaggatcctggctcacttc
ccggaggacctgagtttggccttcgcctacggctccgcggtgtatcgccaggcaggaccc
agtgcccaccaggagaatcccatgttagacttagtgttcacagtagacgaccctgttgcc
tggcacgcgatgaacctgaagaagaattggagccactactccttcctcaaactcttgggg
cccaggatcatctcctccatccagaataattacggtgccggagtctacttcaaccccctg
atcaggtgtgacgggaagcttatcaagtacggggttattagcactggcacactgattgag
gacctcctgaactggaataacctatatatcgccggacgcctccaaaagccggtgaagatc
gtatcgatgaatgagaacatggctcttagagccgccctggataagaacctgaggagtgcc
gtgaccaccgcctgcctcatgctacctgaaagcttctccgaggaagacctgttcatagag
atagctgggctctcctactcaggtgacttccgcatggtgattggcgaggaaaaatcaaaa
gtgttgaacatcgtgaagcccaacgtaggccatttccgagagctctatgagagtatatta
cagaaggacccccaggtggtgtataagatgcatcaaggccaactggagatagataaaagc
ccagaaggacagttcactcagctaatgacactgcccagaaccctacagcagcaaatcaat
cacatcatggaccctcctgggagaaacagagacgtggaagagactctgctgcaggtggct
caggaccccgactgtggagatgtggtgcgactagcgatctcatcaatcgtcagaccttcc
agcatcaggcagagcactaaaggcctttttactgctggtatgaagaagtctgtgatttat
agttcacggaaactgaacaaaatgtggaaagggtggatgagaaaagcgtcctga

DBGET integrated database retrieval system