KEGG   Mus musculus (mouse): 68975
Entry
68975             CDS       T01002                                 

Gene name
Med27, 1500015J03Rik, 2310042P07Rik, AA682045, Cr, Crsp8, D2Ertd434, D2Ertd434e
Definition
(RefSeq) mediator complex subunit 27
  KO
K15170  mediator of RNA polymerase II transcription subunit 27
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    68975 (Med27)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    68975 (Med27)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Other mediators
     68975 (Med27)
SSDB
Motif
Pfam: Med27
Other DBs
NCBI-GeneID: 68975
NCBI-ProteinID: NP_081172
MGI: 1916225
Ensembl: ENSMUSG00000026799
Vega: OTTMUSG00000011597
UniProt: Q9DB40
Position
2 B; 2 19.84 cM
AA seq 311 aa
MADVLSVGVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIANFQDNL
HSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYH
AGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMSIHL
SRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNESVYTEDGKLDIWSKSSYQVFQ
KVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFR
TLEAFHDTCRQ
NT seq 936 nt   +upstreamnt  +downstreamnt
atggcggacgtgctgagcgttggtgtgaacctggaggccttttcgcaggctattagcgcc
atccaggcgctacgctctagcgtgagtagggtcttcgactgccttaaggatggcatgcgc
aacaaagagacgctggagggccgcgagaaggccttcatcgcgaacttccaggacaacttg
cattccgtcaaccgggacctcaatgaactggaacgtttgagcaacctggtaggcaagccg
tctgagaaccaccctcttcataacagtgggctgctaagcctggatcctgtgcaggacaaa
accccactctacagccagcttctgcaagcatacaaatggtccaacaagctgcagtaccat
gcaggtctagcgtctggccttttgaaccaacagtccttgaagcgctctgcaaatcagatg
ggtgtgtctgccaagcggagaccgaaggcccagcccaccactctggttctaccacctcag
tatgtcgatgacgtgatcagccgcattgacagaatgtttccagagatgtccattcactta
tcgagacccaatgggacttcagcaatgcttctggtgaccttggggaaggtgttgaaagtc
attgtggtcatgaggagcctgttcatcgatcgcacgattgtgaaggggtataatgagagc
gtctacacagaggatggaaagctggacatatggtccaaatccagctaccaagtgttccag
aaggtgacagaccatgccaccactgccctgcttcactatcagttaccccagatgccagac
gtcgtggtcaggtccttcatgacctggctgagaagctacattaagctgttccaggccccg
tgccagcgctgtgggaagtttctacaagatggccttcccccgacgtggagagacttccga
accctggaagctttccatgacacctgccgacagtga

DBGET integrated database retrieval system