KEGG   Mus musculus (mouse): 68977
Entry
68977             CDS       T01002                                 

Gene name
Haghl, 1500017E18Rik, 2810014I23Rik, C330022E15Rik
Definition
(RefSeq) hydroxyacylglutathione hydrolase-like
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: HAGH_C Lactamase_B Lactamase_B_2
Other DBs
NCBI-GeneID: 68977
NCBI-ProteinID: NP_001258362
MGI: 1919877
Ensembl: ENSMUSG00000061046
Vega: OTTMUSG00000033886
UniProt: Q9DB32
Position
17; 17 A3.3
AA seq 283 aa
MKVKVIPVLEDNYMYLIIEEHTREAVAIDVAVAERLLEIAGREGVSLTMVLSTHHHWDHT
RGNAELAHILPGLAVLGADERICALTRRLEHGEGLQFGAIHVRCLLTPGHTSGHMSYFLW
EDDCPDSPALFSGDALSVAGCGWHLEDTAQQMYQSLAKTLGTLPPETKVFCGHEHTLSNL
EFAQKVEPCNEHVQAKLSWAQERDDEDIPTVPSTLGEELMYNPFLRVTEDAVRAFTGQVA
PAQVLEALCRERARFQPAVEPPQPQVRALLALQWGLLSTHQKK
NT seq 852 nt   +upstreamnt  +downstreamnt
atgaaggtcaaagtcatcccggtacttgaagacaactacatgtacctgatcattgaggaa
cacacgcgggaggccgtagctatagacgtggctgtggccgagaggttgctggagattgcg
ggtcgcgagggagtgtctctgaccatggtgctgtccacccatcatcactgggaccacaca
cgtggaaatgcggagctggcacacattctgccaggattggctgtcttgggagcagatgag
cgcatttgcgctctaacccgaaggctggaacatggagaagggcttcagtttggggccatc
cacgtgcgatgcctcttgacgccaggccacacctctggccacatgagctacttcctgtgg
gaggatgactgcccggactcaccagccctcttctctggggatgctctgtcagtggcaggc
tgtggctggcacctggaggacactgcccagcagatgtaccagagcttggccaagactctg
ggtacccttccacccgagacgaaggtgttctgtggtcatgagcatacgctgagcaatctt
gagtttgcacagaaagtggagccctgcaacgaacacgtgcaagctaagctgtcctgggcc
caggagagggatgacgaggatattcctactgtgccttcgacgctgggcgaggagctcatg
tacaaccctttcctgagggtgacagaggatgcagtccgtgcgttcacaggccaggtggcc
ccagcccaggtcctggaggccctctgcagggagcgagcgcgcttccagcctgctgtggag
ccaccacagccgcaggttcgggcactcctggccttacagtgggggcttctgagcacacac
cagaaaaagtga

DBGET integrated database retrieval system