KEGG   Mus musculus (house mouse): 68992
Entry
68992             CDS       T01002                                 
Symbol
Zfp580, 1500015O20Rik, Znf580
Name
(RefSeq) zinc finger protein 580
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-H2C2_2 zf-met zf-Di19 DUF5810 zf_UBZ zf-C2H2_9 Zn-ribbon_8 Zn_ribbon_SprT Zn-C2H2_12
Other DBs
NCBI-GeneID: 68992
NCBI-ProteinID: NP_081176
MGI: 1916242
Ensembl: ENSMUSG00000055633
UniProt: Q9DB38
Position
7:5041682..5056722
AA seq 172 aa
MLLLPPRPPHPRSSSPEVMDPPPPKTPPFPKAEGPSSTSSSVAGPRPPRLGRHLLIDANG
VPYTYTVQLEEEPRGPPQREATPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPF
TCGACGKAFKRSSHLSRHRATHRARAGPPHTCPLCPRRFQDAAELAQHVRLH
NT seq 519 nt   +upstreamnt  +downstreamnt
atgctgctgctgccgccgcggccaccccaccctcggtcctcctctccggaggtcatggac
ccaccgccccccaagactcccccttttcccaaggcggaaggcccctcctccacttcttcc
tcggtggcggggccgcggccaccgcggctgggccgccatctgctcatcgacgccaacggg
gtcccctacacgtacacggtgcagctggaggaggaacctcggggcccgccgcagcgcgag
gcgaccccgggagagccaggtcctcgcaagggctatagctgcccagagtgcgctcgtgtc
tttgcgagccctctgcggctgcagagccaccgtgtgtcgcactcggacctcaagcccttt
acttgtggtgcttgtggcaaagctttcaagcgatccagccacctgtcgcggcaccgcgcc
acccaccgtgcgcgcgctggtccacctcacacctgcccgctctgtccacgccgcttccag
gacgccgcggagctggcgcagcacgtgcgcctgcactga

DBGET integrated database retrieval system