KEGG   Mus musculus (house mouse): 69020
Entry
69020             CDS       T01002                                 
Symbol
Zfp707, 1500031N24Rik, AI451708, AW495315
Name
(RefSeq) zinc finger protein 707
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    69020 (Zfp707)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    69020 (Zfp707)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    69020 (Zfp707)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB BolA Zn-ribbon_8 zf-C2H2_jaz OGG_N
Other DBs
NCBI-GeneID: 69020
NCBI-ProteinID: NP_001074534
MGI: 1916270
Ensembl: ENSMUSG00000034429
UniProt: Q8R0U9
Position
15:75840972..75847717
AA seq 338 aa
MLLREEWECLSPSQRTLYRNVMLENFRNLNELGCCSRRPGLITRLEQWDEPWVDDWDRSE
FPDGQKSFCPGSRKVAHSRIGAGRGAALRKSALTSGKVRLPRATSGRRMDKREAFQNRIC
GKSHRKQPDLKEQGQSGPEGQPFICGICGKALSCHSRLAAHQTVHTGTRSFECLECGRTF
RWASNLLRHQRNHTSEKPFCCELCGQAFSLKDRLAQHRKIHTEHRPYECGDCGKAFKQKS
NLLRHKLVHTGEKPFYCDTCGKAFRTKENLSHHQRIHSGEKPYTCGECGKAFRWPKGFSI
HQRLHLTKKFYQCEQCGKGFRHLGFFTRHQRTHGRGEV
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgctcctccgggaagaatgggagtgtctcagtcctagccagaggaccctttaccggaat
gtgatgctggagaacttcaggaacttgaatgaactgggatgctgtagccggagaccgggc
cttattacccgtctggaacaatgggatgagccatgggttgatgactgggacagatctgag
tttccagatggacaaaaaagtttctgcccaggaagcagaaaggtggcccattcacggata
ggagccgggagaggggctgccttgaggaagagtgccctgacttccggtaaggtgcgcctt
cccagagctacctctgggaggagaatggacaaaagggaagctttccagaaccggatatgt
ggaaaatcccacaggaagcagccagacctcaaggagcagggccagagcggcccggaggga
cagccatttatctgtggcatctgtgggaaggccctgagctgccacagccggctggccgct
caccagacagtccacacgggaaccaggtcctttgagtgcctcgagtgtggccggacgttc
cgctgggcttcaaaccttctgcgccaccagaggaatcacacaagcgaaaagcccttctgc
tgtgagctctgcgggcaggccttcagcttgaaggaccgcctggcgcagcatcgcaaaatc
cacactgaacaccggccctacgagtgcggcgactgcgggaaggccttcaagcagaagtcg
aacctcctgcggcacaagctcgtgcacaccggggagaagcccttctactgcgacacctgc
ggcaaggcctttcggactaaggagaacctcagccaccaccagcggattcacagcggagag
aagccctacacctgcggggagtgcggcaaggccttcaggtggcccaagggcttcagcatc
caccagaggctgcacttgaccaagaagttctatcagtgtgagcagtgcggaaagggcttc
cgccacctgggcttcttcacgcgacatcagagaactcacgggcgaggagaagtgtag

DBGET integrated database retrieval system