KEGG   Mus musculus (mouse): 69029
Entry
69029             CDS       T01002                                 

Symbol
Smdt1, 1500032L24Rik, Emre
Name
(RefSeq) single-pass membrane protein with aspartate rich tail 1
  KO
K22830  essential MCU regulator, mitochondrial
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    69029 (Smdt1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Mitochondrial calcium uniporter complex
    69029 (Smdt1)
SSDB
Motif
Pfam: DDDD
Other DBs
NCBI-GeneID: 69029
NCBI-ProteinID: NP_081190
MGI: 1916279
Ensembl: ENSMUSG00000022452
Vega: OTTMUSG00000034180
UniProt: Q9DB10
Position
15:82229901..82233266
AA seq 107 aa
MASTAARRLAWVAVRPGALWSGPRGRRGGDVYTVPGSSGLSQVPSRSVIVTRSGAILPKP
VKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD
NT seq 324 nt   +upstreamnt  +downstreamnt
atggcgtccacggcggctcggcggctggcctgggttgcagttcgacccggggctctctgg
agcgggccgagggggaggagaggtggcgatgtctacaccgtaccgggcagctcaggtctc
agccaggtaccgtcgaggtcagtcatcgtcactcgcagcggcgccattttgcccaagccg
gtgaaaatgtcctttggtcttctccgagtgttctccattgtgatcccctttctctatgtc
gggacactcatcagcaagaacttcgctgctctgcttgaggaacatgacatttttgtccca
gaggatgacgacgacgacgattaa

DBGET integrated database retrieval system