KEGG   Mus musculus (mouse): 69038Help
Entry
69038             CDS       T01002                                 

Gene name
Tmem258, 1810006K21Rik
Definition
(RefSeq) transmembrane protein 258
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Ost5 Phage_holin_3_3
Motif
Other DBs
NCBI-GeneID: 69038
NCBI-ProteinID: NP_081195
MGI: 1916288
Ensembl: ENSMUSG00000036372
Vega: OTTMUSG00000034055
UniProt: P61166 Q60FD1
Position
19; 19 A
AA seq 79 aa AA seqDB search
MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA
SLFMGFGVLFLLLWVGIYV
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggagctcgaagccatgagtaggtacaccagcccagtgaacccggctgtcttccctcac
ctgactgtggtacttctggccatcggcatgttcttcactgcctggttcttcgtttacgag
gtcacctctaccaagtacacacgcgatatttacaaagagctcctcatctccttggtggcc
tcactcttcatgggctttggagtcctcttcctcctgctctgggttggcatctacgtataa

DBGET integrated database retrieval system