KEGG   Mus musculus (mouse): 69046
Entry
69046             CDS       T01002                                 

Gene name
Isca1, 1810010A06Rik, Hbld, Hbld2
Definition
(RefSeq) iron-sulfur cluster assembly 1
  KO
K22063  iron-sulfur cluster assembly 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    69046 (Isca1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    69046 (Isca1)
SSDB
Motif
Pfam: Fe-S_biosyn
Other DBs
NCBI-GeneID: 69046
NCBI-ProteinID: NP_081197
MGI: 1916296
Ensembl: ENSMUSG00000044792
Vega: OTTMUSG00000029126
UniProt: Q9D924
Position
13; 13 B2
AA seq 129 aa
MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGL
SYSLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT
CGCGESFHV
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtcggcgtcgttggtccgcgccaccgtgcgggctgtgagcaagagaaaactgcagccc
acgcgggcggccctcacactgaccccctctgctgtaaacaagataaaacaacttcttaaa
gacaaacctgagcatgtgggtctgaaagttggcgtgcgaaccaggggctgtaatggcctc
tcttacagcctggagtacacaaagacaaaaggagattctgatgaagaagttattcaagat
ggagtccgagtgttcatcgagaagaaagcacagctaaccctgttaggaacagagatggac
tatgtggaagacaaactgtccagtgagtttgtgttcaataaccccaacatcaagggaacc
tgtggctgcggtgagagctttcacgtgtga

DBGET integrated database retrieval system