KEGG   Mus musculus (house mouse): 69048
Entry
69048             CDS       T01002                                 
Symbol
Slc30a5, 1810010K08Rik, AF233321, ZNT5, ZTL1, ZnT-5, Zntl1
Name
(RefSeq) solute carrier family 30 (zinc transporter), member 5
  KO
K14692  solute carrier family 30 (zinc transporter), member 5/7
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    69048 (Slc30a5)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC30: Zinc efflux transporter
   69048 (Slc30a5)
SSDB
Motif
Pfam: Cation_efflux
Other DBs
NCBI-GeneID: 69048
NCBI-ProteinID: NP_075023
MGI: 1916298
Ensembl: ENSMUSG00000021629
UniProt: Q8R4H9
Position
13:complement(100939153..100969988)
AA seq 761 aa
MEEKYGGDARPGPGGGLGPVDVPSARLTRYILLLCLTKCLKAVGLFESYDLLKAVHIVQF
IFILKLGTAFFMVLFQKPFSSGKPITKHQWIKIFKHAVAGCIISLLWFFGLTLCGPLRTL
LLFEHSDIVVISLLSVLFTSSGGGPAKTRGAAFFIIAVICLLLFDNDDLMAKMAEHPEGH
HDSALTHMLYTAIAFLGVADHKGGVLLLVLALCCKVGFHTASRKLSIDVGGAKRLQALSQ
LVSVFLLCPWVIVLSVTTESKVESWFSLIMPFTTVIFFVMILDFYMDSVCSVKMDVSKCA
RYGSFPIFISALLFGNFWTHPITDQLRAMNRAAHQESTEHVLSGGVVVSAVFFILSANIL
SSPSKRGQKGTLIGYSPEGTPLYHFMGDAFQHSSQSVPRFIKDSLKQVLEESDSRQIFYF
LCLNLLFTFVELFYGVLTNSLGLISDGFHMLFDCSALVMGLFAALMSRWKATRIFSYGYG
RIEILSGFINGLFLIVIAFFVFMESVARLIDPPELDTNMLTPVSVGGLIVNLIGICAFSH
AHSHGHGASQGNCHSDHGHSHHAHGHGHDHGHSHGFTGGGMNANMRGVFLHVLADTLGSI
GVIVSTVLIEQFGWFIADPLCSLFIAVLIFLSVIPLIKDACQVLLLRLPPDHEKELHIAL
EKIQKIEGLISYRDPHFWRHSASIVAGTIHIQVTSEVLEQRIVQQVTGILKDAGVNNLTI
QVEKEAYFQHMSGLSTGFHDVLAMTKQMESLKYCKDGTYIM
NT seq 2286 nt   +upstreamnt  +downstreamnt
atggaggagaagtacggcggggacgcgcggcccgggcccggcggtggcctcgggccggtg
gacgtgcccagcgcccgattaacaagatacattttattgctgtgtttaaccaaatgtttg
aaggctgtgggactttttgaatcatatgatctcctaaaagctgttcacattgttcaattt
atttttatattaaaacttgggactgcattttttatggttttgtttcaaaaaccgttttct
tctgggaaacctattacaaagcatcagtggatcaaaatatttaaacatgcagttgctgga
tgtatcatatcacttttatggttttttggccttactctttgtggaccactaaggaccttg
ctgctgtttgaacacagtgacattgtcgtaatctctctgctcagtgttctgttcactagc
tctggaggaggaccagcaaagacaagaggggctgcttttttcattattgctgtgatctgc
ttactgcttttcgacaatgatgatctcatggcaaagatggctgaacacccggaaggacat
catgatagtgctctaactcacatgctctatacagccattgcctttttaggggtggcagat
cacaagggtggagtactcttgctggtgctggctttatgttgtaaagttggttttcatacg
gcttccagaaagctctctatagatgttggtggagctaagcgccttcaggccttatctcag
cttgtttctgtgtttctcctgtgcccatgggtgattgttctttctgtgacgactgagagt
aaggttgagtcttggttctctctcatcatgcctttcaccacagtcatcttttttgtcatg
atcctggatttctatatggattctgtttgttcagtcaaaatggacgtgtccaaatgtgcc
cgctatgggtcctttcccatttttattagtgccctcctgtttggaaatttctggacacac
ccaataacagaccaactccgggctatgaacagagcagcacaccaggagagcacagagcac
gtcctgtctggaggagtggtagtgagcgctgtgttcttcattttgtcggccaacattcta
tcatctccctctaagagaggacagaaaggtacccttattggatattctcctgaaggaaca
ccactctatcacttcatgggggacgcttttcagcacagctctcagtcggtgcctaggttc
attaaggactcactaaagcaggttctcgaggagagcgactctaggcagatcttttacttc
ttgtgcttgaatctgctttttacctttgtggagttgttctatggcgtgctaaccaacagt
ctaggcctgatctcagatggatttcacatgctctttgactgctcggctttggtcatggga
ctgtttgctgccctgatgagccgctggaaagccacccggattttctcctatgggtatggc
cgaatagagattctctctggctttattaatgggctttttctgatcgtgatagcatttttt
gtgtttatggaatcagtggctagactgatcgatcctccggaactagacacaaacatgctg
acaccagtttccgtcggagggctgatagtaaaccttattggtatctgtgccttcagccac
gcccacagccatggccatggcgcttctcaaggaaactgccactctgatcacggccattca
caccatgcacatggacacggccatgatcacggtcacagccacggcttcacgggtggaggc
atgaatgcgaacatgaggggtgtatttctccatgtgttggcagacacactgggcagcatc
ggcgtgattgtgtccacagttctcatagagcagtttggatggttcattgctgatcccctg
tgttctctttttattgccgtgttgatatttctcagtgtgatcccactgattaaagatgcc
tgtcaagttctacttctgagactaccacctgaccatgaaaaagaactgcatattgcttta
gaaaagatacagaaaattgagggattaatatcataccgagaccctcatttttggcgccat
tctgccagtattgtagcgggaacaattcatatacaagtgacatctgaggtgctggagcag
agaattgtacagcaggttacagggatacttaaagatgcaggagtaaacaacctaaccata
caagtggaaaaggaggcatactttcagcatatgtccggcctgagtactggatttcatgat
gttctggctatgacgaagcagatggaatccctgaaatactgcaaagatggcacttacatc
atgtga

DBGET integrated database retrieval system