KEGG   Mus musculus (mouse): 69060
Entry
69060             CDS       T01002                                 

Gene name
Pnlip, 1810007A24Rik, PL, PTL
Definition
(RefSeq) pancreatic lipase
  KO
K14073  pancreatic triacylglycerol lipase [EC:3.1.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu01100  Metabolic pathways
mmu04972  Pancreatic secretion
mmu04975  Fat digestion and absorption
mmu04977  Vitamin digestion and absorption
Module
mmu_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    69060 (Pnlip)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    69060 (Pnlip)
   04975 Fat digestion and absorption
    69060 (Pnlip)
   04977 Vitamin digestion and absorption
    69060 (Pnlip)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     69060 (Pnlip)
SSDB
Motif
Pfam: Lipase PLAT Abhydrolase_6 Palm_thioest LIDHydrolase DUF900 Hydrolase_4
Other DBs
NCBI-GeneID: 69060
NCBI-ProteinID: NP_081201
MGI: 97722
Ensembl: ENSMUSG00000046008
UniProt: Q6P8U6
Position
19 D2; 19 54.46 cM
AA seq 465 aa
MLMLWTFAVLLGAVAGREVCFDKLGCFSDDAPWSGTLDRPLKALPWSPAQINTRFLLYTN
ENPDNYQLITSDASNIRNSNFRTNRKTRIIIHGFIDKGEENWLSDMCKNMFRVESVNCIC
VDWKGGSRTTYTQATQNVRVVGAEVALLVNVLQSDLGYSLNNVHLIGHSLGSHIAGEAGK
RTFGAIGRITGLDPAEPYFQGTPEEVRLDPTDAQFVDAIHTDAGPIIPNLGFGMSQTVGH
LDFFPNGGIEMPGCQKNILSQIVDIDGIWEGTRNFAACNHLRSYKFYTDSIVNPTGFAGF
SCSSYSLFTANKCFPCGSGGCPQMGHYADRYPGKTSRLYQTFYLNTGDKSNFARWRYQVT
VTLSGQKVTGHILVSLFGNGGNSKQYEVFKGSLQPGTSHVNEFDSDVDVGDLQKVKFIWY
NNVINPTLPKVGASRITVERNDGRVFNFCSQETVREDVLLTLSPC
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgctaatgctgtggacatttgcagtgctgctgggagcagtagctggaagggaagtttgc
ttcgacaaactcggctgcttcagtgatgatgccccctggtcaggaactctagacagaccc
ctgaaagcactgccctggagcccagcacagatcaacacccgctttctcctctacaccaac
gagaatccagacaactaccagctaattacttcagatgcatcaaacatcagaaactccaat
ttccgaacaaacagaaaaacccgtatcattatccacggcttcatcgacaagggagaagaa
aactggctatctgacatgtgcaagaacatgttccgagtggagagtgtgaactgcatctgt
gtggactggaaaggcggttcccgaacgacatatacccaggctacccagaacgtccgggtc
gtgggggcagaagtggcattgttggttaacgttctgcagtctgatctgggatactcactt
aacaatgtccacctgattggccacagcctgggttcccacattgctggggaggctggaaag
aggacctttggagccattggaaggatcacagggttggaccccgctgagccttacttccag
ggcacccctgaagaagtccgactggaccccaccgatgctcagtttgtggacgcaattcac
acagacgccgggcccattatccccaacttaggatttggaatgagccagactgtgggtcac
ttagatttctttccaaacggaggaatcgaaatgccaggatgccagaagaatattctttcc
caaattgttgacatcgacgggatctgggaaggaactcgaaactttgctgcctgtaaccac
ttaagaagctacaagttttacaccgacagcatcgtcaacccaactggctttgctgggttc
tcctgtagctcttacagtcttttcacggcaaataagtgcttcccatgtgggagtggagga
tgcccccagatgggtcattacgctgacagatatcctgggaaaacaagcagactctaccag
acattttacctcaacaccggtgataagagcaacttcgcacgttggcggtaccaggtgact
gtcaccctgtctggacagaaggtcactgggcacattctagtttctttgtttggaaatgga
ggaaactctaaacagtatgaagttttcaagggctctctgcagccaggtacttctcacgtc
aatgaattcgactctgatgtggatgttggagatttgcagaaggttaaatttatttggtac
aacaatgtgatcaacccaactctacccaaagtgggagcatcaaggatcacagtggaaaga
aatgatggcagagtgttcaacttctgtagtcaagagacagtgagggaagacgtcctgctc
acactgtctccatgttag

DBGET integrated database retrieval system