KEGG   Mus musculus (mouse): 69068Help
Entry
69068             CDS       T01002                                 

Gene name
Tcim, 1110065B09Rik, 1810011O10Rik, AW121743, AW321058
Definition
(RefSeq) transcriptional and immune response regulator
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: TC1 tRNA_bind_2 HalOD1
Motif
Other DBs
NCBI-GeneID: 69068
NCBI-ProteinID: NP_081207
MGI: 1916318
Ensembl: ENSMUSG00000056313
Vega: OTTMUSG00000045584
UniProt: Q9D915
Position
8; 8 A2
AA seq 106 aa AA seqDB search
MKAKPSHQATSMSSSLRVSPSIHGYHFDTAARKKAVGNIFENIDQESLQRLFRNSGDKKA
EERAKIIFAIDQDLEEKTRALMALKKRTKDKLLQFLKLRKYSIKVH
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccaagccaagccatcaagccaccagcatgtcctcgtctcttcgagtaagcccg
tccatccacggctaccacttcgacacagccgctcgcaagaaagctgtgggcaacatcttt
gagaacatagaccaggagtccctgcagaggctcttcaggaactccggagacaagaaggca
gaggagcgggccaagatcatttttgccatcgaccaagatttggaggagaaaactcgagcc
ctcatggccctgaagaagaggacaaaagacaagcttcttcagtttctcaaactgcggaaa
tattccatcaaggtacactga

DBGET integrated database retrieval system