KEGG   Mus musculus (mouse): 69076
Entry
69076             CDS       T01002                                 

Gene name
Triap1, 1810015M01Rik, AU020874, AU043831, P53csv, Wf-1
Definition
(RefSeq) TP53 regulated inhibitor of apoptosis 1
  KO
K17968  TRIAP1/MDM35 family protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    69076 (Triap1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    69076 (Triap1)
SSDB
Motif
Pfam: UPF0203 COX17 CX9C CHCH UCR_hinge DUF5339
Other DBs
NCBI-GeneID: 69076
NCBI-ProteinID: NP_081209
MGI: 1916326
Ensembl: ENSMUSG00000029535
Vega: OTTMUSG00000014653
UniProt: Q9D8Z2
Position
5; 5 F
AA seq 76 aa
MNSVGEACTDMKREYDQCFNRWFAEKFLKGDGSGDPCTDLFKRYQQCVQKAIKEKEIPIE
GLEFMGHGKEKPENSS
NT seq 231 nt   +upstreamnt  +downstreamnt
atgaacagcgtcggggaggcttgcactgacatgaagcgcgagtacgaccagtgcttcaac
cgctggtttgctgagaagttcctcaaaggggacggctccggggacccgtgcaccgacctc
ttcaaacgctaccagcagtgcgtgcagaaagcaatcaaggagaaagagattcctattgaa
ggcctggagttcatgggccatggcaaagaaaagcctgaaaactcctcttga

DBGET integrated database retrieval system