KEGG   Mus musculus (house mouse): 69077
Entry
69077             CDS       T01002                                 
Symbol
Psmd11, 1700089D09Rik, 1810019E17Rik, 2610024G20Rik, 2810055C24Rik, P44.5, S9
Name
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 11
  KO
K03036  26S proteasome regulatory subunit N6
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    69077 (Psmd11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    69077 (Psmd11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    69077 (Psmd11)
   05012 Parkinson disease
    69077 (Psmd11)
   05014 Amyotrophic lateral sclerosis
    69077 (Psmd11)
   05016 Huntington disease
    69077 (Psmd11)
   05017 Spinocerebellar ataxia
    69077 (Psmd11)
   05020 Prion disease
    69077 (Psmd11)
   05022 Pathways of neurodegeneration - multiple diseases
    69077 (Psmd11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    69077 (Psmd11)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     69077 (Psmd11)
SSDB
Motif
Pfam: RPN6_N PCI RPN6_C_helix TPR_12 DDRGK DUF2153 AAA_16
Other DBs
NCBI-GeneID: 69077
NCBI-ProteinID: NP_848731
MGI: 1916327
Ensembl: ENSMUSG00000017428
UniProt: Q8BG32 Q5BKQ9 Q3UWW9
Position
11:80319441..80364074
AA seq 422 aa
MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKT
GQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSE
KRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHAL
SNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYD
SIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLA
DFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKAD
VERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYSKAKK
LT
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggcggccgcagcggtggtggagttccagagagcccagtctctactcagcaccgaccgg
gaggcctccatcgacatcctccactccatcgtgaaacgtgacattcaagaaaatgatgag
gaggcagtccaggtcaaagagcagagcatccttgaactgggttctctcctggcgaagact
ggacaagctgctgagcttggaggactcctgaagtatgtacggcctttcttgaattccatc
agtaaagctaaagcagctcgtctggtccggtctcttcttgatctgtttctagatatggaa
gcagccacagggcaggaggtcgagctatgtttagagtgcatcgaatgggccaaatcagag
aaaagaactttcttacgccaagcattggaggcaaggctggtgtctttgtattttgatacc
aagaggtaccaggaagcattgcatttgggttctcagctgcttcgggagttgaaaaagatg
gatgataaagcccttttggtggaagtacagcttttagaaagcaaaacttaccatgctctg
agtaatctgccgaaagcccgagctgccttaacctctgctcgaaccacagcaaatgccatc
tactgcccccctaaattgcaggccaccctggacatgcagtcaggcattattcatgcagca
gaggagaaggactggaaaactgcatactcatacttctatgaggcattcgaaggctacgac
tccattgatagccccaaggccatcacatctctgaagtacatgttgctgtgcaaaatcatg
ctcaacaccccagaagatgtccaggctttggtgagcggaaagcttgcacttcggtatgca
gggaggcagacagaagcattgaaatgtgtggctcaagctagcaagaacagatcactggca
gattttgaaaaggccctgacagactacagggcagagctccgggatgacccaatcatcagc
acacatttggccaagctgtacgataacttactggaacagaatctgatccgggtcatcgag
cctttttcccgagtccagattgaacacatatctagcctcatcaaactctccaaggccgac
gtggaaagaaaattatcacagatgattcttgacaagaagtttcatgggattttggaccag
ggggagggtgtcctgatcattttcgatgaacccccagtagataaaacttatgaagctgct
ctggaaactattcagaacatgagtaaagtagtggactccctctacagcaaagccaagaag
ctgacatag

DBGET integrated database retrieval system