KEGG   Mus musculus (mouse): 69080
Entry
69080             CDS       T01002                                 

Gene name
Gmppa, 1810012N01Rik
Definition
(RefSeq) GDP-mannose pyrophosphorylase A
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00051  Fructose and mannose metabolism
mmu00520  Amino sugar and nucleotide sugar metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    69080 (Gmppa)
   00520 Amino sugar and nucleotide sugar metabolism
    69080 (Gmppa)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     69080 (Gmppa)
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep DUF4954
Other DBs
NCBI-GeneID: 69080
NCBI-ProteinID: NP_598469
MGI: 1916330
Ensembl: ENSMUSG00000033021
Vega: OTTMUSG00000019424
UniProt: Q922H4
Position
1; 1 C4
AA seq 420 aa
MLKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQ
PDEALTQFLEAAQQEFNLPVRYLQEFAPLGTGGGLYHFRDQILAGAPEAFFVLNADVCSD
FPLSAMLEAHRRQRHPFLLLGTTANRTQSLNYGCIVENPQTHEVLHYVEKPSTFISDIIN
CGIYLFSPEALKPLRDVFQRNQQDGQLEESPGSWPGAGTIRLEQDVFSALAGQGQIYVHL
TDGIWSQIKSAGSALYASRLYLGRYQITHPERLARHTPGGPRIRGNVYIHPTAKVAPSAV
LGPNVSIGKGVTIGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPNDP
NPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgctcaaagctgtgattctcattggaggcccccagaaggggactcgcttcaggcctttg
tcttttgaggtgcccaaacctctgtttcctgtggcaggcgttcccatgatccagcaccat
atagaagcctgtgcccaggtcccagggatgcaggagattcttctcattggcttctaccag
cctgatgaggccctcacccagttcctggaagctgcccagcaggagtttaaccttccagtc
aggtacctgcaggagtttgcccccctcggcacagggggtggcctctaccattttcgggac
cagatcctggctggggcacctgaggccttcttcgtgctcaatgctgacgtctgctctgac
ttccccttgagcgccatgttggaggctcacaggcgccagcgccaccctttcttactcctt
ggcaccacggctaacaggacacaatccctcaactacggctgcatcgttgagaatccacag
actcatgaggttctgcactatgtggagaaacccagcacctttatcagtgacatcatcaac
tgtggcatctaccttttctccccagaagccctgaagcctctccgggatgttttccagcgt
aaccaacaggatgggcaactggaggagtccccaggctcgtggcctggcgcagggaccatc
cgactagaacaggacgtgttctcagccctggctgggcagggccaaatctacgtgcacctc
accgatggtatctggagccagatcaagtctgcaggctcagccctttatgcctcccgcctc
tatctggggcgataccagatcactcacccagaacggctagccagacacactccagggggc
ccacgcatcagaggaaatgtttacatccatccaaccgctaaagtggccccatcagctgtg
ctgggccccaatgtctccattgggaagggggtgaccataggcgagggtgtgcgtctgcga
gagagcattgtcctccatggagccactttgcaggaacacacctgcgtccttcacagcatt
gtgggctgggggagcactgtggggcgctgggcccgtgtagaggggactcccaatgacccc
aatccgaatgacccccgagctcgcatggacagtgagagcctcttcaaagatggaaagctg
cttcctgccatcactatcctgggctgccgtgttcggatccctgccgaggtgctcatcttg
aactcaattgttctaccacataaggagctaagtcgaagcttcaccaaccaaatcatcctg
tga

DBGET integrated database retrieval system