KEGG   Mus musculus (house mouse): 69089
Entry
69089             CDS       T01002                                 
Symbol
Oxa1l, 1810020M02Rik
Name
(RefSeq) oxidase assembly 1-like
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03060  Protein export
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    69089 (Oxa1l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    69089 (Oxa1l)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmu02044]
    69089 (Oxa1l)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    69089 (Oxa1l)
Secretion system [BR:mmu02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   69089 (Oxa1l)
SSDB
Motif
Pfam: 60KD_IMP DUF624
Other DBs
NCBI-GeneID: 69089
NCBI-ProteinID: NP_081212
MGI: 1916339
Ensembl: ENSMUSG00000000959
UniProt: Q8BGA9
Position
14:54598298..54607130
AA seq 433 aa
MARNLVCGRWQLLRLLRPQRSYHSVAVSLRPLAAELLAARRGNGRPPCALLAVFTPRCIS
TSATLFAEAQVQAPPVIPATSIPAAVPEVASGGAADVVQCATEPSFTELGLGSYTPVGLI
QNLLEYIHVDLGLPWWGAIATCTVLARCLVFPLIVKGQREAAKIHNHMPEMQKFSARIRE
AKLAGDQAEFYKATIEMTRYQKKHDIKLLRPLILPLTQAPVFISFFIALREMANLPVPSL
QTGGLWWFQDLTVSDPIYVLPLVVTATMWCVLELGAETGVQSNDLQFMRNIIRVMPLVVL
PVTIHFPSAVFMYWLSSNVFSLCQVACLRIPAVRTVLKIPQRVVHDPDKLPPREGFLKSF
KKGWKNAEIAQQLREREQRMQKHLDLAARGPLRQTFTHNPLLQHDPSHPPKAPNSNNSSI
KANAKKPWQDTLG
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggcgaggaatttagtgtgcggtcgctggcagcttctgcgactcctacgaccccagcgt
tcgtaccatagcgtcgcagtgtccctgagaccgctggccgccgagctcctcgcagcccgc
cggggtaacgggcggccaccctgtgctcttctcgccgtcttcactcctcgctgcatcagt
acatctgccaccctctttgcagaagcccaggtccaggcaccccctgttattcctgctacc
tctatccctgctgcagtaccagaggtagcttctggaggagctgcagatgtagtccagtgt
gctaccgaaccgagcttcacagaactggggcttggttcttacaccccggtgggtctcatc
cagaacctcttggaatatatacatgtcgacctgggcctgccgtggtggggagccattgcc
acgtgtactgtccttgcccgatgcctcgtttttcctctcattgtgaagggccagcgagaa
gcagccaagatccacaaccacatgccagagatgcagaagttttccgctcgaatcagagag
gccaagttggccggagaccaggctgagttttacaaggccaccatagagatgacacgctat
cagaaaaagcatgatattaaactcttgagaccgctcatcctacctctcactcaggccccc
gtcttcatctccttctttattgccttgagagagatggccaacctgcctgtgcccagcctc
cagacaggtgggctctggtggttccaagatctcaccgtgtctgatcccatctacgtcttg
ccactggtagtcactgccacaatgtggtgtgtccttgagctaggtgctgagacaggtgtt
cagagcaatgaccttcagttcatgaggaacattatcagggtgatgcccctggtggtcttg
cctgtgaccatccacttcccctcggcagtgttcatgtactggctgtcctccaacgtgttc
tccctgtgccaagtagcctgcctccggattccagctgtgcgcacagtgctgaagatcccc
cagcgagtcgtacatgaccctgacaaattgcctcctagggaaggcttcttgaagagcttc
aaaaaaggctggaagaacgctgaaattgcacagcagctccgagagcgggagcagcgaatg
cagaaacacttggacctggctgccaggggtcccttacgacagacttttacgcacaaccct
ctgctgcagcatgatccaagtcaccccccgaaagctcccaacagcaacaacagcagcatc
aaagcaaacgcaaagaagccttggcaagacacactcggttga

DBGET integrated database retrieval system