KEGG   Mus musculus (house mouse): 69091
Entry
69091             CDS       T01002                                 
Symbol
Vps26b, 1810012I05Rik, 2310075A12Rik, AI848392
Name
(RefSeq) VPS26 retromer complex component B
  KO
K18466  vacuolar protein sorting-associated protein 26A/B
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    69091 (Vps26b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    69091 (Vps26b)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    69091 (Vps26b)
SSDB
Motif
Pfam: Vps26 Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 69091
NCBI-ProteinID: NP_821170
MGI: 1917656
Ensembl: ENSMUSG00000031988
UniProt: Q8C0E2
Structure
Position
9:complement(26915798..26941390)
AA seq 336 aa
MSFFGFGQSVEVEILLNDAESRKRAEHKTEDGKKEKYFLFYDGETVSGKVSLSLKNPNKR
LEHQGIKIEFIGQIELYYDRGNHHEFVSLVKDLARPGEITQSQAFDFEFTHVEKPYESYT
GQNVKLRYFLRATISRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNK
SKYHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVR
GESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR
KSMSHQAAIASQRFEGTTSLGEVRTPGQLSDNNSRQ
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgagcttcttcggcttcgggcagagcgtggaggtggaaatcttgctgaatgatgcggag
agtaggaagcgagcggagcacaagactgaggacgggaagaaggagaaatatttcctcttc
tacgacggggaaaccgtctcggggaaagtgagcctatcactgaagaaccccaacaagcga
ctagagcaccagggcatcaagatcgagttcattgggcagatcgaactctactatgaccgt
gggaaccaccatgagtttgtgtctttggtgaaggacctggctcggccaggagagatcacc
caatcgcaggccttcgactttgagttcacccatgtggaaaagccgtatgaatcctacaca
ggacagaatgtgaagctccgctatttccttcgagccaccatcagccgccgcctcaatgat
gttgttaaagagatggacattgtagttcacacacttagcacataccccgagctgaactca
tccatcaagatggaagttggcattgaggattgcctgcacattgaatttgagtacaacaaa
tccaaataccacttgaaagatgtcattgtagggaagatatacttcctgctggtgagaatc
aagatcaagcacatggagatagacatcatcaaacgagagacaacaggcacgggtcccaac
gtgtaccacgagaacgacacaatagcgaagtatgagatcatggacggggcaccagtccga
ggtgagtccatccccatcaggctcttcctggcagggtatgagctcacacccaccatgcgt
gacataaataagaagttctctgtgcgctattacctcaacttggtgctgatagatgaggag
gaacggcgctacttcaagcagcaggaagtggtgttgtggcggaagggtgacatcgtacgg
aagagcatgtcccaccaggcagccattgcctcacagcgcttcgagggcacaacctccctg
ggtgaggtgcggacccctggccaactgtctgacaacaacagcaggcagtag

DBGET integrated database retrieval system