KEGG   Mus musculus (house mouse): 69125
Entry
69125             CDS       T01002                                 
Symbol
Cnot8, 1500015I04Rik, 1810022F04Rik, AA536816, AU015770, AU043059
Name
(RefSeq) CCR4-NOT transcription complex, subunit 8
  KO
K12581  CCR4-NOT transcription complex subunit 7/8
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    69125 (Cnot8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    69125 (Cnot8)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     69125 (Cnot8)
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     69125 (Cnot8)
SSDB
Motif
Pfam: CAF1
Other DBs
NCBI-GeneID: 69125
NCBI-ProteinID: NP_081225
MGI: 1916375
Ensembl: ENSMUSG00000020515
UniProt: Q9D8X5
Position
11:57983620..58009423
AA seq 292 aa
MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDY
QYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSG
LQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHE
FFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFR
MKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDCAQEKMSILAMINNMQQ
NT seq 879 nt   +upstreamnt  +downstreamnt
atgcctgcggcacttgtagaaaacagtcaggtcatctgtgaggtgtgggccagcaatctt
gaggaagagatgcggaagatccgtgagattgtcctcagctacagctatatcgctatggac
acagagttcccaggtgttgttgtacggccgatcggtgaatttcgaagctccatagattac
cagtatcagcttctgcggtgcaatgttgatcttcttaaaatcatccagctgggccttacg
ttcaccaatgagaagggggagtacccgtctggaatcaacacatggcagttcaacttcaag
ttcaacctgacagaggatatgtactcccaggattccatagatctgcttgcaaactcaggg
ctgcagttccagaaacacgaggaggaagggatcgatacactgcactttgcagagctgctt
atgacatcgggagtggttctctgtgacaacgtcaagtggctttcatttcacagtggttat
gattttggctacatggtaaagctgctaacagactctcgcctgccggaagaagaacacgag
ttctttcatatcctgaatcttttcttcccgtccatttacgatgtgaaatacctgatgaag
agctgcaaaaacctgaagggaggccttcaggaggtggctgatcagttggatctgcagagg
atcggaaggcagcatcaagcaggctcagactctctgctgacggggatggctttcttcagg
atgaaagagctattctttgaggacagtattgacgatgccaagtattgtgggcgcctctat
ggcctgggcacaggggtggcccagaagcagaatgaggatgtggactgtgcccaggagaag
atgagcatcttggccatgatcaacaacatgcagcagtga

DBGET integrated database retrieval system