KEGG   Mus musculus (house mouse): 69149
Entry
69149             CDS       T01002                                 
Symbol
Kbtbd3, 2200003A07Rik, Bklhd3
Name
(RefSeq) kelch repeat and BTB (POZ) domain containing 3
  KO
K10471  kelch repeat and BTB domain-containing protein 3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    69149 (Kbtbd3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     69149 (Kbtbd3)
SSDB
Motif
Pfam: BACK BTB Kelch_1 Kelch_6 Kelch_4 Kelch_2
Other DBs
NCBI-GeneID: 69149
NCBI-ProteinID: NP_001158046
MGI: 1916399
Ensembl: ENSMUSG00000025893
UniProt: Q8BHI4
Position
9:4309743..4331829
AA seq 607 aa
MDNSYNLNEQSSWNGISSEKKKNYLASEDHGQKILSVLQSFREQNVFYDFKIIMKEEIIP
CHRCVLAACSDFFRAMFEVNMKERDDGSVTITNLSSKAVKAFLDYAYTGKTRITDDNVEM
FFQLSSFLQVSFLSKACSDFLIKSISLVNCLHLLSLSDSYGSAQLFSHTLYFVQHHFHLL
YKSSDFLEMNFGVLQKCLESDELNVPEEEMVLKAVLTWIKYNLESRQKHLPHLITKVRLH
QLSEDTLQDYLLNEEYLLKSTNCFDIIVDAIKCVQGSSGLFPDARPSTTEKYIFIHKTEE
NGENQYTFCYNIKTDSWKILPQSHLIDLPGSSLSSYGEKIFLTGGCKGKCCRRIRLHIAQ
SYHDATDQTWCYCPAKNEFFCVSAMKTPRTMHTSVMALNRLFVIGGKTRGSQDIKSLLDV
ESYNPLSREWTSVSPLPRGIYYPEASACQNIIYVLGSEVEIADAFNPSLDCFFKYNATTD
QWSELVAEFGQFFHATLIKAVPVNCTLYICDLSTYKVYSFCPDTCVWKGEGSFECAGFNA
GAIGIEDKIYILGGDYAPDEITDEVQVYHSSRSEWEEVSPMPRALTEFYCQVIQFNKYRD
PWYSNHF
NT seq 1824 nt   +upstreamnt  +downstreamnt
atggataattcatacaatttaaatgaacaaagctcatggaatggaatctcatctgagaag
aaaaaaaattaccttgcatcagaagatcatggacagaaaatcttaagtgtgctgcagagt
tttagagaacagaatgtcttttatgacttcaaaataatcatgaaagaagaaataatccca
tgtcatcgttgtgtgttggctgcatgcagtgactttttcagggctatgttcgaagtaaac
atgaaagaaagagatgacggaagtgttaccattactaacttgtcctccaaagctgtaaag
gcatttcttgactatgcctatacgggaaaaacaagaataacagatgataacgtggaaatg
ttcttccagttgtcatcctttcttcaggtttccttcctgtccaaagcttgcagtgacttt
ttaataaaaagcattagtctggtcaactgtttgcatttgttatctctgtcagacagctac
ggctctgcccagttgttcagtcacactttatattttgtgcagcatcactttcatttgttg
tataaatccagtgactttttagaaatgaattttggagtgctgcagaagtgtctggaatca
gatgaattgaacgtacctgaagaagaaatggtcctaaaggctgtcctcacatggattaag
tacaacttagagtccaggcaaaaacacctgcctcacttgattaccaaagtaagattacat
cagttatctgaggacacacttcaagactatttgctcaatgaagagtatttactcaaaagc
acaaactgttttgacataatcgtggatgccattaagtgtgtacaaggttctagtggcctc
tttcctgatgctcgaccatccacaactgaaaaatatatattcatccataagactgaggaa
aatggagaaaatcaatatacattttgctataatattaaaactgactcctggaaaatattg
ccacaatcacatctgattgatttgccaggatctagtctgtctagctatggagagaaaata
ttcttgacaggtggttgcaaagggaagtgctgtagaaggattcgacttcatattgcacag
tcttaccatgatgccactgaccagacctggtgctactgtccagctaaaaatgagtttttc
tgtgtttcagccatgaaaaccccaagaaccatgcatacatcagtcatggctctcaatcga
ttatttgttataggcggaaaaactagagggtcccaggacattaaaagtctcttagatgtt
gaatcttataatccactgtccagagagtggacatcagttagccctttacccagaggcatc
tattacccagaagccagtgcatgccagaatatcatttatgtccttggatctgaggtagag
attgccgatgctttcaacccatcacttgattgcttttttaaatataatgctacaactgac
cagtggtctgaactagtagcagagtttgggcagttttttcacgctactttaattaaagct
gtcccagtaaactgcaccctttatatatgtgatctttccacctataaggtttatagtttt
tgtcctgatacttgtgtttggaaaggagaagggtcttttgagtgtgcaggttttaatgca
ggtgcaattggaattgaggataagatttacatattaggtggagattatgcaccagatgag
attacagatgaagtgcaggtctaccacagtagtaggtcagagtgggaagaggtgtcacca
atgccaagagctttaactgaattttactgtcaggtcattcagttcaacaaatacagggac
ccatggtattcaaatcatttctaa

DBGET integrated database retrieval system