KEGG   Mus musculus (mouse): 69162
Entry
69162             CDS       T01002                                 

Gene name
Sec31a, 1810024J13Rik, ABP125, ABP130, AU042160, HSPC275, Sec31, Sec31l1
Definition
(RefSeq) Sec31 homolog A (S. cerevisiae)
  KO
K14005  protein transport protein SEC31
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    69162 (Sec31a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    69162 (Sec31a)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmu02044]
    69162 (Sec31a)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    69162 (Sec31a)
Secretion system [BR:mmu02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   69162 (Sec31a)
SSDB
Motif
Pfam: Sec16_C SRA1 Prp18
Other DBs
NCBI-GeneID: 69162
NCBI-ProteinID: NP_081245
MGI: 1916412
Ensembl: ENSMUSG00000035325
Vega: OTTMUSG00000043627
UniProt: Q3UPL0
Position
5; 5 E4
AA seq 1230 aa
MKLKEIDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDLSDPSLDMKSC
ATFSSSHRYHKLIWGPHKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQKDK
HTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPMTPGAKTQPPEDISCIAWNRQV
QHILASASPSGRATVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDVATQMVLASEDDRLPV
IQMWDLRFASSPLRVLENHARGILAVAWSMADPELLLSCGKDAKILCSNPNTGEVLYELP
TNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSIDGLRQKQVDKLSSSFGNLDPFG
TGQPLPPLQIPQQSAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFESVAVPLQQGAEQ
QRRQPVFISQVVTEKDFLNRSAQLQHAVQSQGFIGYCQKKIEASQTEFEKNVWSFLKVNF
EEDSRGKYLELLGYRKEDLGQKIALALNKVDGPDVALKDSDQVAQSDGEESPAAEEQLLG
ERIKEEKQECDFLPSAGGTFNISVSGDIDGLITRALLTGNFESAVDLCLHDNRMADAIIL
AIAGGQELLAQTQKKYFAKSQSKITRLITAVVMKNWREIVESCDLKNWREALAAVLTYAK
PDEFSALCDLLGTRLEREGDSLLRTQACLCYICAGNVERLVACWTKAQDGSSPLSLQDLI
EKVVILRKAVQLTQALDTNTVGALLAEKMSQYASLLAAQGSIAAALAFLPDNTNQPNIVQ
LRDRLCKAQGKPVSGQESSQSPYERQPLSKGRPGPVAGHSQMPRVQTQQYYPHGENPPPP
GFIMQGNVIPNPAAPLPTAPGHMPSQLPPYPQPQPYQPAQQYSFGTGGAAAYRPQQPVAP
PASNAYPNTPYISPVASYSGQPQMYTAQQASSPTSSSAASFPPPSSGASFQHGGPGAPPS
SSAYALPPGTTGTPPAASELPASQRTENQSFQDQASILEGPQNGWNDPPALNRVPKKKKM
PENFMPPVPITSPIMNPSGDPQSQGLQQQPSTPGPLSSHASFPQQHLAGGQPFHGVQQPL
AQTGMPPSFSKPNTEGAPGAPIGNTIQHVQALPTEKITKKPIPEEHLILKTTFEDLIQRC
LSSATDPQTKRKLDDASKRLEFLYDKLREQTLSPTIINGLHSIARSIETRNYSEGLSVHT
HIVSTSNFSETSAFMPVLKVVLSQASKLGV
NT seq 3693 nt   +upstreamnt  +downstreamnt
atgaagttaaaggagatagatcgtacagctatgcaggcatggagccctgcccagaaccac
cccatttacctagccacaggaacatccgctcagcagttggatgcgacgtttagtaccaat
gcttccctcgagatattcgagctggacctttcggacccatccttggatatgaagtcttgt
gctacgttctcctcttctcacaggtaccacaagttgatctggggacctcataagatggat
tccaaaggagatgtttctggagttctgattgcaggtggagaaaatggaaacattattctt
tatgatccttctaaaattatagctggagacaaggaagttgtgattgcccaaaaggacaag
catactgggccagtgagagccttggatgtgaacatcttccagaccaatttggtggcctct
ggtgctaatgaatctgaaatctacatttgggatctaaacaattttgcaactccaatgacg
ccgggagctaaaacacagccaccagaagatatcagctgcatagcatggaacagacaagtt
cagcatatcttagcatcagccagtcccagtggccgggcaactgtctgggatctcaggaaa
aacgagcctatcatcaaagtcagtgaccacagtaacaggatgcattgctctgggctggcg
tggcaccctgatgtggctactcagatggtcctcgcctctgaggatgatcgattaccagtg
atccagatgtgggaccttcgatttgcctcctctcctctccgggttctggaaaatcatgcc
agggggattttggcagttgcttggagcatggcagatcctgagttgttgttaagctgtgga
aaagatgctaagattctctgctctaaccctaacacaggagaggtattatatgaacttccc
accaacacacagtggtgctttgatatccagtggtgtcctcgaaatcctgctgtcctgtcc
gctgcttcctttgatggacggatcagtgtctattccatcatgggagggagcatagacggc
ttacggcagaaacaagttgacaagctttcatcatcttttgggaatcttgatcctttcggc
acaggacagcctctccctccattacaaatcccacagcagagcgctcagcacagcatagtg
ctgcccctgaagaagcctcccaagtggatccggaggcctgtgggcgcttccttctcgttt
ggagggaagttggtgacttttgagagcgttgcagtgccgctgcagcagggagctgagcag
cagcgacggcagcctgtgttcatcagtcaggtggtgacggagaaggactttctcaaccgg
tcggcgcagctgcagcatgctgtgcagtctcagggcttcatcggttactgccagaaaaag
atcgaggcttcccagaccgagtttgagaaaaatgtgtggtccttcttgaaggtaaacttt
gaggaggattctcgtggaaaataccttgagcttctgggatacagaaaggaagatctgggg
cagaagattgctttggccttgaacaaagtggacggacccgatgtggctcttaaggactct
gaccaagtagcgcagagtgatggggaggagagtcctgctgctgaagagcagctcttggga
gagcgcattaaagaggaaaaacaggaatgtgactttctgccctcggcgggagggacgttt
aacatctctgtcagtggggatattgacggtctaattacccgggccttgctgacaggcaat
tttgagagtgcagttgacctttgcttacatgataaccgaatggctgatgccattatatta
gccatagcaggtggacaggaactcttggctcaaacacaaaagaaatacttcgcaaaatcc
caaagcaaaattaccaggcttatcactgcagtggtgatgaagaactggagggagattgtt
gaatcctgtgatcttaagaattggagagaggctttagctgcagtcctcacttacgctaaa
ccagacgagttctcggccctgtgcgatctcctgggaacccgtctggaaagagaaggagac
agcctcctgcggactcaggcctgcctctgctacatctgtgcagggaatgtagagagattg
gttgcttgctggacaaaagctcaggacggcagcagccccttgtctctccaggatctgatt
gagaaagttgtcatcctccgcaaagctgtacagctcacccaagccttggacaccaatact
gtcggggctcttctggctgagaagatgagtcagtatgccagcttgttggcagcccagggc
agcattgccgcagccttggcttttctgcctgacaacaccaaccagccaaatattgtgcag
ctgcgtgacagactctgtaaagctcaaggcaagcctgtgtcgggacaggaatcttctcag
agcccatatgagaggcagccactgtccaagggcaggcctggaccagttgctggccactcg
cagatgcccagagttcaaactcagcaatattatccccatggagaaaatcccccacctcca
ggtttcataatgcagggcaatgtcattccaaaccctgctgccccgctgcccacggctcca
ggccacatgcccagccagctgccaccttacccacagccgcagccttaccagccagcccag
cagtattccttcggaacagggggggcagcagcttatcgacctcaacagcctgttgctcct
cctgcttctaacgcttaccctaacaccccgtacatatctcctgtggcttcctattctggg
cagcctcagatgtacacagcccagcaagcctcctcacctacctccagctctgctgcttct
ttcccccctccctcctctggagcatccttccagcatggcggaccaggagctccaccatca
tcttcagcttatgcactgcctcctggaacaacaggtacaccgcctgctgccagtgagctg
cctgcgtcccaaagaacagaaaatcaatctttccaagaccaggcatctatattggaaggt
cctcagaatggttggaatgatcctccagctctgaacagagtgccgaagaagaagaagatg
cctgaaaacttcatgcctcctgttcccattacgtcaccaatcatgaacccttcgggtgat
ccccagtcacaggggctgcagcagcagccttcaactccagggccgctgtcaagccacgcc
tccttcccacagcagcacctagcgggcggccagcccttccatggtgtacagcagcctctt
gctcagacaggcatgccgccgtccttctcaaagcccaacactgaaggggctccaggagct
cccattggaaacaccatccagcacgtgcaggctctgccaacagaaaagattactaagaaa
cctattccggaggagcacctcatcctaaagacgacatttgaggaccttatccagcgctgc
ctctcctccgctacagacccccaaaccaagaggaagctggacgacgccagcaagcgcctg
gagttcctctacgacaagcttagggaacagacactctccccgaccatcatcaacggtctc
cacagcatcgccaggagcattgagacgaggaactactcggaagggttgagcgtccacact
cacatcgtcagcaccagcaacttcagtgagacctcggccttcatgcccgtcctcaaggtt
gtcctcagtcaggccagcaagctgggtgtctga

DBGET integrated database retrieval system