KEGG   Mus musculus (mouse): 69169Help
Entry
69169             CDS       T01002                                 

Gene name
Fcmr, 1810037B05Rik, Faim3, FcmuR, Toso
Definition
(RefSeq) Fc fragment of IgM receptor
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: V-set NICE-3
Motif
Other DBs
NCBI-GeneID: 69169
NCBI-ProteinID: NP_081252
MGI: 1916419
Ensembl: ENSMUSG00000042474
Vega: OTTMUSG00000026802
UniProt: A1KXC4 A0A0G2LB91
Position
1; 1 E4
AA seq 422 aa AA seqDB search
MDFWLWLLYFLPVSGALRVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPGICST
VVSNTFVKKEYERRVTLTPCLDKKLFLVEMTQLTENDDGIYACGVGMKTDKGKTQKITLN
VHNEYPEPFWEDEWTSERPRWLHRFLQHQMPWLHGSEHPSSSGVIAKVTTPTPKTEAPPV
HQPSSITSVTQHPRVYRAFSVSATKSPALLPATTASKTSTQQAIRPLEASYSHHTRLHEQ
RTRHHGPHYGREDRGLHIPIPEFHILIPTFLGFLLLVLLGLVVKRAIQRRRASSRRAGRL
AMRRRGRGASRPFPTQRRDASQRPRSQNNVYSACPRRARGPDSLGPAEAPLLNAPASASP
ASPQVLEAPWPHTPSLKMSCEYVSLGYQPAVNLEDPDSDDYINIPDPSHLPSYAPGPRSS
CQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggacttttggctttggttactttacttcctgccagtgtctggggccctgagagtcctc
ccagaagtacagctgaatgtagagtggggtggatccattatcatcgaatgcccactccct
caactacacgtaaggatgtatctgtgtcggcagatggccaaacctgggatatgctccact
gtggtgtccaacacctttgtcaagaaggaatatgaaaggcgagtcaccctgacgccatgc
ttggataagaagctattcctagtggagatgacacagctgacggaaaatgacgatggaatc
tatgcctgtggtgtgggcatgaagacagacaaaggcaagacccagaaaatcaccctgaat
gtccataatgaatacccagaaccattctgggaagatgaatggacctctgagcggccaaga
tggttgcacagatttctgcagcaccagatgccctggctccacgggagtgaacatcccagc
tcttctggagtcatagccaaagttaccacgccaactccaaagactgaggcccctccggtt
caccagccctccagcatcacttcagtaacccaacatcccagagtttacagagcattttct
gtgtcagctaccaagtccccagcgctcctgccagcaaccacagcctcaaagacttccact
cagcaagcaatcaggcccctagaggccagctacagccaccacaccagacttcatgagcaa
aggacacgccaccatggcccacactatgggagagaagaccgagggcttcacatccccatc
ccagaatttcacatcctgattccgaccttcctgggctttctcttgctggttcttttggga
ctggtggtaaaaagagccattcaaaggaggagagcctcctccagacgtgcgggccgacta
gcgatgaggaggcgaggccggggggcttcccgcccgttccccacacagcgccgggatgcc
tcgcagaggccgcgctcgcagaacaacgtctacagcgcctgcccccggcgcgcacgggga
ccagacagcttgggtccagcggaggctccgctcctcaacgccccagcctcagcgtccccc
gcttctccgcaggtacttgaagctccttggccccacaccccatctctgaagatgagctgt
gaatacgtgagcttgggctaccagcctgctgtcaacctggaagaccctgattcagatgat
tacatcaatattcctgacccatctcatctccctagctatgccccagggcccagatcttca
tgccaatga

DBGET integrated database retrieval system