KEGG   Mus musculus (mouse): 69171
Entry
69171             CDS       T01002                                 

Gene name
Cnppd1, 1810031K17Rik, AU043960
Definition
(RefSeq) cyclin Pas1/PHO80 domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Cyclin Cyclin_N
Other DBs
NCBI-GeneID: 69171
NCBI-ProteinID: NP_081253
MGI: 1916421
Ensembl: ENSMUSG00000033159
Vega: OTTMUSG00000048448
UniProt: Q8K158
Position
1; 1 C4
AA seq 407 aa
MDLTGLLLDEEGAFSLTGFQDFMVLPGHQKLSARIRRRLYYGWDLETDCSLEELSSPVAD
ITVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPDYLQHVSSS
DLFLISMMVASKYLYDEGEEEEVFNDEWGAAGGVAVATLNALERSFLSAMDWRLYTDPRE
IFEVLSWLESCVAEQQGRRRGWYTYTDLCVLLEQPTWQLALGSLCQRLVKLSCLLAVAYV
SSVALAVASVAVIHQSLGLSSSPSPGPPELTLVSKSLVQPCVPAPVSQCLTNVSSCLEGS
VDLPSLWGSLLAPLTPPLRPPPDPPAPPTPLHKCPLCQKFQRLPPNCRACHTNQTVSIGP
SRPLYHARGLAPPWLWSPVAPPFLQPQQCSLFSVMELAHLKSVISPG
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggacctgactgggctcctgctggacgaagaaggcgccttctccctcaccggtttccaa
gacttcatggtccttccaggacaccaaaagctaagtgctcgaatccgaaggagactctat
tatggctgggacttggagacagactgcagcctggaggagctctccagccctgtggcagac
attactgtggaacttcttcagaaggcagcacccagtcctattcgccgactccagaaaaaa
tatgtagcccatgtgtcccgagaggcttgtatctccccttgtgctatgatgctagctctg
gtgtacattgagcggctccggcaccgaaacccagattatctgcagcacgtgtcgtcttct
gatttgtttctgatctccatgatggtggccagtaaatacctttatgatgaaggggaggaa
gaggaggtcttcaatgacgaatggggggcagctgggggagtcgccgtggccaccctcaat
gccttggaaaggagcttcctgagtgccatggattggcgtctctacactgatcctcgggag
atctttgaggtgctaagttggctggagagctgtgtggctgagcagcaaggacggcggcgg
ggctggtacacctacacagacctgtgtgtgctgctggagcagccaacgtggcagctggct
ctgggctccctctgccagcggctggtaaagctgtcctgcctgttagctgtggcatatgtg
agcagcgtggccctagctgtagcatcagtggctgtaatacaccagtctttggggctgtcc
tccagcccctcaccaggtcctcctgaactcacactggtctccaagagcctcgtgcagccc
tgcgtacctgcccctgtgtcacagtgcctgactaatgtctccagctgcctggaaggcagt
gtagacttgccatcactctggggcagtcttctggccccattgactccccctctgagacct
cccccagaccctcctgcccctcctactcctctccacaaatgtcccctttgccagaagttc
cagagactccccccaaactgccgtgcctgccacactaaccaaacggtgtctattgggcct
tcccgccccctttaccatgcccgcggcctggccccaccctggctctggagcccagtggcc
cctccatttctccagccccagcagtgttcgctttttagtgtcatggagctggctcatctc
aagtctgtcatttccccaggctag

DBGET integrated database retrieval system