KEGG   Mus musculus (mouse): 69219
Entry
69219             CDS       T01002                                 

Gene name
Ddah1, 2410006N07Rik, 2510015N06Rik, AI987801, AW050362
Definition
(RefSeq) dimethylarginine dimethylaminohydrolase 1
  KO
K01482  dimethylargininase [EC:3.5.3.18]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    69219 (Ddah1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.18  dimethylargininase
     69219 (Ddah1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   69219 (Ddah1)
SSDB
Motif
Pfam: Amidinotransf
Other DBs
NCBI-GeneID: 69219
NCBI-ProteinID: NP_081269
MGI: 1916469
Ensembl: ENSMUSG00000028194
Vega: OTTMUSG00000029461
UniProt: Q9CWS0 Q3UF01
Position
3; 3 H2
AA seq 285 aa
MAGLGHPSAFGRATHAVVRAPPESLCRHALRRSQGEEVDFARAERQHELYVGVLGSKLGL
QVVQLPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMK
DENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADSLHLKSFCSM
AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDMAANCIYLNIPSKGHVLLHRTPE
EYPESAKVYEKLKDHLLIPVSNSEMEKVDGLLTCCSVFINKKIDS
NT seq 858 nt   +upstreamnt  +downstreamnt
atggccggcctcggccacccctccgccttcggccgggccacccacgccgtggtgcgggct
ccgcccgagtccctgtgccgccacgcgctgaggcgctcgcagggcgaggaggtggatttc
gctcgcgccgagcgccagcacgagctctacgtgggcgtgctgggcagcaagctggggctg
caggtggtgcagctgcccgccgacgagagcctgcccgactgcgtgttcgtggaggacgtg
gccgtcgtgtgcgaggagacggccctcatcacccgccccggggcgcccagccgcaggaag
gaggttgacatgatgaaagaggctttggaaaaacttcagctcaacatagtagagatgaaa
gatgaaaatgcaactttggatggtggggacgtcctattcacaggcagagaattttttgtg
ggcctttccaaaagaacaaatcaacgaggtgctgaaatcttggctgatacttttaaggac
tacgcagtctctacagtccctgtggccgattctttgcatttaaagagtttctgcagcatg
gccggacccaacctgattgcaatagggtccagcgaatctgcacagaaggccctcaagatc
atgcaacagatgagtgaccatcgttatgacaagctcactgtacccgacgacatggccgcc
aactgcatatatctaaatatccccagcaaagggcatgtcttgctgcaccgaaccccagaa
gagtacccagaaagcgcaaaggtctatgagaaactcaaggaccatctactgatccctgtg
agcaactcggagatggaaaaggtggacggcttgctcacctgctgctccgtttttattaac
aagaagatagactcctga

DBGET integrated database retrieval system