KEGG   Mus musculus (mouse): 69226
Entry
69226             CDS       T01002                                 

Gene name
Snx24, 2810011K15Rik, 5730433I16Rik, AI451341
Definition
(RefSeq) sorting nexing 24
  KO
K17941  sorting nexin-22/24
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    69226 (Snx24)
SSDB
Motif
Pfam: PX DUF3080
Other DBs
NCBI-GeneID: 69226
NCBI-ProteinID: NP_083670
MGI: 1916476
Ensembl: ENSMUSG00000024535
UniProt: Q9CRB0
Position
18; 18 D1
AA seq 169 aa
MEVYIPSFRHEDSDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPS
KHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDET
ESEESSKLSHQPVLLFLGDPYVLPAASDFPNVVIEGVLHGIFFSHLQPR
NT seq 510 nt   +upstreamnt  +downstreamnt
atggaggtctacatcccgtcctttcgccacgaggacagcgatctggagcgcggctacacg
gtgtttaaaatagaagtgctaatgaacggaagaaaacattttgttgagaaacggtacagc
gaattccatgccttgcacaaaaagcttaagaaatgtataaagactccagaaatcccttct
aaacacgtcaggaactgggtccccaaagtcttggaacaacggcggcaaggcctggaaacg
tatttacaggccgtcattttggagaatgaagagcttcccaaactcttccttgacttcctc
aatgtacggcacttgccctctctaccgaaagcagaaagctgtggatctttcgatgagaca
gagtctgaagagtcaagcaagctgtcccaccagccggtgctgctgttccttggggatcca
tacgtcttgcctgcagccagcgattttccaaatgtggtcatcgaaggagttcttcatggg
atatttttctctcacctgcagcccaggtag

DBGET integrated database retrieval system