KEGG   Mus musculus (mouse): 69227
Entry
69227             CDS       T01002                                 

Symbol
Selenot, 2810407C02Rik, 5730408P04Rik, Selt
Name
(RefSeq) selenoprotein T
  KO
K22366  thioredoxin reductase-like selenoprotein T
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    69227 (Selenot)
SSDB
Motif
Pfam: Rdx
Other DBs
NCBI-GeneID: 69227
NCBI-ProteinID: NP_001035486
MGI: 1916477
Ensembl: ENSMUSG00000075700
Vega: OTTMUSG00000021242
UniProt: P62342
Position
3:58484057..58500965
AA seq 195 aa
MRLLLLLLVAASAVVRSEASANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMR
VISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQW
GQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNE
MKLNVHMDSIPHHRS
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaggctcctgctgcttctgctggtggcggcgtcggcggtggtccgcagcgaggcctct
gccaacctgggcggcgtgcccagcaagagattaaagatgcagtacgccaccgggccgctg
ctcaagttccagatttgtgtatcctgagggtaccggcgggtgtttgaggagtacatgcgg
gttatcagccagcggtatccagacatccgcattgaaggcgagaattatctccctcaacca
atttatagacacatagcatctttcctgtcagtcttcaaactagtattaataggcttaata
attgttggcaaagatccttttgcttttttcggcatgcaagctcctagcatctggcagtgg
ggccaagaaaataaggtttatgcatgtatgatggttttcttcctgagcaacatgattgag
aaccagtgtatgtcaacaggtgcatttgagataactttaaatgatgtgccagtgtggtct
aagctggaatctggacatcttccatccatgcaacaacttgttcaaattcttgacaatgaa
atgaaactcaatgtgcatatggattcaatcccacatcatcgatcatag

DBGET integrated database retrieval system