KEGG   Mus musculus (mouse): 69232Help
Entry
69232             CDS       T01002                                 

Gene name
Qrich1, 2610028H07Rik, b2b2404Clo
Definition
(RefSeq) glutamine-rich 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3504 CARD
Motif
Other DBs
NCBI-GeneID: 69232
NCBI-ProteinID: NP_001107591
MGI: 1916482
Ensembl: ENSMUSG00000006673
Vega: OTTMUSG00000050759
UniProt: Q3UA37 G3X8R5
Position
9; 9 F2
AA seq 777 aa AA seqDB search
MNNSLENTISFEEYIRVKARSVPQHRMKEFLDSLASKGPEALQEFQQTATTTMVYQQGGN
CIYTDSTEVAGSLLELACPVTTSVQPQTQQEQQIQVQQPQQVQVQVQVQQSPQQVSAQQL
SPQFTVHQPAEQPIQVQVQIQGQAPQSAAPSIQTPSLQSPSPSQLQAAQIQVQHVQAAQQ
IQAAEIPEEHIPHQQIQAQLVAGQSLAGGQQIQIQTVGALSPPPSQQGSPREGERRVGTA
SVLQPVKKRKVDMPITVSYAISGQPVATVLAIPQGQQQSYVSLRPDLLTVDSAHLYSATG
TITSPTGETWTIPVYSAQPRGDPQQQSITHIAIPQEAYNAVHVSGSPTALAAVKLEDDKE
KMVGTTSVVKNSHEEVVQTLANSLFPAQFMNGNIHIPVAVQAVAGTYQNTAQTVHIWDPQ
QQPQQQTAQEQTPPPQQQQQQLQVTCSAQTVQVAEVEPQSQPQPSPELLLPNSLKPEEGL
EVWKNWAQTKNAELEKDAQNRLAPIGRRQLLRFQEDLISSAVAELNYGLCLMTREARNGE
GEPYDPDVLYYIFLCIQKYLFENGRVDDIFSDLYYVRFTEWLHEVLKDVQPRVTPLGYVL
PSHVTEEMLWECKQLGAHSPSTLLTTLMFFNTKYFLLKTVDQHMKLAFSKVLRQTKKSPS
NPKDKSTSIRYLKALGIHQTGQKVTDDMYAEQTENPENPLRCPIKLYDFYLFKCPQSVKG
RNDTFYLTPEPVVAPNSPIWYSVQPISREQMGQMLTRILVIREIQEAIAVANATTMH
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgaataattctctagagaacaccatctcatttgaagagtacatccgagtaaaggcgagg
tctgtcccgcaacacaggatgaaggaatttctggactcactggcttctaagggaccagaa
gctcttcaggagttccagcagactgccaccaccaccatggtgtaccagcagggtgggaac
tgcatttatacagacagcactgaagtggctgggtctttgcttgaacttgcttgtccagtc
acaaccagtgttcaaccacaaactcagcaagagcagcagatccaggttcagcagccacag
caggttcaggtacaggtgcaggtgcagcagtctccacaacaggtctcagctcagcaactt
tccccacagttcaccgttcaccagcctgctgagcaacccatccaggtccaggtgcagatc
cagggccaagcaccacagtccgcagccccctccattcagactccatctctgcagagcccc
agcccctcacagctgcaagcagctcagatccaggtgcagcacgtccaggcggcccaacag
atccaggctgcagaaatcccagaggagcatatcccacatcaacaaatccaggctcagttg
gtagctggccaatctcttgctgggggccagcaaattcaaattcagactgtgggtgctctt
tccccaccaccatcccagcagggctcacccagggaaggggaacggagggttggcacagcc
agtgtccttcagccagtgaagaaacgcaaagtggacatgcctatcaccgtgtcctacgcc
atctcagggcagccagtggccactgtgctggccattccacaaggccagcaacagagttat
gtgtctttgaggccagacttactgacagtagacagtgcccacctgtacagtgccactggg
accataactagccctacaggagaaacttggaccatccctgtttattctgcccagccccgc
ggggatcctcagcagcagagcattacgcacattgccattccccaggaagcctacaatgcg
gttcatgtcagtggctcacctacggccctggcagctgtaaagctggaggatgacaaggag
aagatggtgggcaccacatctgtagtgaaaaactcccatgaagaggtagtgcagaccctt
gcaaactctctctttccagcacagttcatgaatggcaacatccacattccagtggctgtg
caggctgtagcaggcacataccagaatacggctcagactgtacatatatgggacccacag
cagcagccacaacagcaaactgcacaagagcagacaccaccaccacaacagcagcagcag
cagctgcaggtcacttgttcagcacagactgttcaggttgctgaagttgagccacagtca
caaccacagccttcaccagagcttttgcttccaaattctttgaagccagaagaagggctt
gaagtatggaaaaactgggctcagaccaagaatgctgaactagaaaaggatgctcaaaac
agattggcccccattgggaggcgacagttgctacgatttcaggaagatctgatctcctct
gctgtggctgaattgaattatggcctttgtttaatgacacgagaagctcggaatggagaa
ggtgaaccctatgacccagatgtactctactacattttcctgtgtatacagaagtatctt
tttgaaaatggaagagtagatgacatattttctgatctttactatgttcgtttcaccgaa
tggctacatgaagttctgaaggatgtacagcctcgggtcactccacttggctatgtgttg
cccagtcacgtgactgaagagatgctgtgggaatgtaagcagcttggggcacattcccct
tccacactgctgaccaccctcatgttctttaacaccaagtacttcctgttgaagactgta
gatcagcacatgaagctggctttctctaaggtcctccgacagacaaagaagagcccctcg
aatcctaaggataaaagcacgagcatccgctacctgaaggccctcggaatacaccagact
ggccagaaagttacagatgacatgtatgcagagcaaacagagaatccagagaatccacta
aggtgtcccatcaagctctacgatttctacctctttaaatgccctcagagtgtgaaaggc
cgaaatgacaccttttacctgacacctgagccagttgtagctcccaacagcccaatctgg
tactcagtccagcctatcagcagagaacagatgggacagatgctgacccggatcctggtt
atacgagaaatccaagaagccattgccgtggccaatgcaaccaccatgcactga

DBGET integrated database retrieval system