KEGG   Mus musculus (mouse): 69241
Entry
69241             CDS       T01002                                 

Gene name
Polr2d, 2310002G05Rik, 2610028L19Rik, HSR, HSRBP4, RB, RBP4
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide D
  KO
K03012  DNA-directed RNA polymerase II subunit RPB4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    69241 (Polr2d)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    69241 (Polr2d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    69241 (Polr2d)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    69241 (Polr2d)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     69241 (Polr2d)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      69241 (Polr2d)
SSDB
Motif
Pfam: RNA_pol_Rpb4 Maelstrom Tfb4
Other DBs
NCBI-GeneID: 69241
NCBI-ProteinID: NP_081278
MGI: 1916491
Ensembl: ENSMUSG00000024258
UniProt: Q9D7M8
Position
18; 18 B1
AA seq 142 aa
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY
NT seq 429 nt   +upstreamnt  +downstreamnt
atggcggcgggtggaagcgatcctcgggctggcgacgtagaagaagacgcttcccagctt
atctttcccaaagagtttgagacagcggagactctgctgaactcggaagtccacatgctt
ctggagcatcgaaagcagcagaacgagagcgcggaggacgagcaggagctgtcggaggtc
ttcatgaaaaccctcaactacacggcccgcttcagccggttcaaaaacagagagaccatt
gccagtgtgcgcagcttgcttctccagaaaaagttacataagtttgagttggcctgttta
gccaatctttgcccggagactgctgaagagtccaaagctctgattccaagcctggaaggg
cgttttgaagatgaggagctgcagcagattctcgatgacatccagacgaagcgcagcttc
cagtactga

DBGET integrated database retrieval system