KEGG   Mus musculus (mouse): 69257
Entry
69257             CDS       T01002                                 

Symbol
Elf2, 2610036A20Rik, A230104O07Rik, AW111824, BB183398, EU32, NERF, NERF-1A, NERF-1B, NERF-2
Name
(RefSeq) E74-like factor 2
  KO
K09428  E74-like factor 1/2/4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    69257 (Elf2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    69257 (Elf2)
SSDB
Motif
Pfam: Elf-1_N Ets
Other DBs
NCBI-GeneID: 69257
NCBI-ProteinID: NP_075991
MGI: 1916507
Ensembl: ENSMUSG00000037174
Vega: OTTMUSG00000051593
UniProt: Q9JHC9
Position
3; 3 C
AA seq 593 aa
MASAVVDSGGSALELPSDGGENQEGGDTGPDCPAVIVEPVPSARLEQGYAAQVLVYDDET
YMMQDVAEEQEVETENSETVEASVHSSNAHCTDKTIEAAEALLHMESPTCLRDSRSPVEV
FVPPCISTPEFIHAAMRPDVITETVVEVSTEESEPMDASPIPTSPDSHEPMKKKKVGRKP
KTQQSPVSNGSPELGIKKKAREGKGNTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKL
VDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKDMPKNIVVID
DDKSETCPEDLAAAADDKSLERVSLSAESLLKAATAVRGGKNSSPLNCSRAEKGVARVVN
ITSPTHDGSSRSPTTTAPVSAAAAPRTVRVAMQVPVVMTSLGQKISAVAVQSVNAGTGSP
LITSTSPASASSPKVVIQTVPTVMPASTENGDRITMQPAKIITIPATQLAQCQLQAKSNL
TGSGSINIVGTPLAVRALTPVSIAHGTPVMRLSVPAQQASGQTPPRVISALLKGPEGKSE
AKKQEHDVKTLQLVEEKGADGNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggcatcggcggtggttgacagcggaggctctgctctggagcttcctagcgatggagga
gaaaatcaagagggaggtgacacgggccctgactgcccggcagtgattgtggagccagtt
cccagtgcgaggttagagcagggctatgctgcccaggtgctggtctatgacgacgagact
tatatgatgcaggatgtggcggaagaacaggaagttgagacggagaattcagaaacagtg
gaagcatcagttcacagcagtaatgctcactgtacggataagaccattgaagctgctgaa
gccctgcttcatatggaatctcctacctgcttgagggattcaagaagtcctgtggaagtg
tttgtccctccttgtatatcaactccagagtttatccatgctgcgatgaggccggatgtc
atcacagagactgtagtggaggtgtccacagaagagtctgagccgatggatgcctcgcct
atccctacttcaccagacagccacgaaccaatgaaaaagaaaaaagttggccgtaaacca
aagacccagcagtcaccagtttccaatgggtctcctgagttaggaatcaagaagaaagcc
agagaaggaaaaggaaacacaacctatctgtgggagtttcttttagatttgcttcaagat
aaaaatacttgtcccaggtatattaaatggactcagagagaaaagggcatattcaaactt
gtggactcaaaggctgtctcgaagctctgggggaagcataagaacaaaccagatatgaac
tatgaaaccatggggcgagcgttaagatattactaccaaaggggaattcttgcaaaggtt
gaaggacagaggcttgtatatcagttcaaggacatgcccaaaaacatagtggtcattgat
gatgacaaaagtgagacctgccctgaagacttggcagcagctgctgatgacaagtcttta
gaacgagtgtcactatctgcagaaagtctcctgaaggcagcaactgccgtccgaggtggg
aaaaactcatctcctctgaactgctccagagcagagaagggtgtggctagagttgtgaac
atcacctcccctactcacgacggttcctccaggtctcctactaccactgcacctgtgtca
gcagcagcagctccaaggacagttcgtgtggcaatgcaagtccctgtggtaatgacctca
ctgggccaaaagatttcagcggtggcagttcagtcagtcaatgcaggcacaggctcgccg
ttaataaccagcaccagtccagcctcggccagctctccaaaagtagtcatccagacagtc
ccgaccgtgatgccggcctccactgaaaatggagacagaatcaccatgcagcctgccaag
attatcaccatccccgccacccagctcgcacagtgtcaactccaggcaaagtcaaacctg
acggggtcaggaagcattaacattgttggaaccccactggctgtgagggcactcacccct
gtttcaatagcccacggtacacctgtaatgagactgtctgtgcctgctcagcaggcttct
ggccagactcctcctcgagttatcagtgcgctcctaaaagggccggaggggaaatcagaa
gccaaaaagcaggaacacgatgtgaaaactttgcagctggtagaagagaagggggcagac
ggcaataagacagtaacccacgtagtggtcgtcagtgcgccgtctgctatcgcccttcct
gtgactatgaaaaccgaagggctagtgacgtgtgagaaataa

DBGET integrated database retrieval system