KEGG   Mus musculus (mouse): 69259
Entry
69259             CDS       T01002                                 

Gene name
Kctd5, 2610030N08Rik, mKIAA0176
Definition
(RefSeq) potassium channel tetramerisation domain containing 5
  KO
K21914  BTB/POZ domain-containing protein KCTD2/5/17
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    69259 (Kctd5)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     69259 (Kctd5)
SSDB
Motif
Pfam: BTB_2 BTB SAM_LFY
Other DBs
NCBI-GeneID: 69259
NCBI-ProteinID: NP_081284
MGI: 1916509
Ensembl: ENSMUSG00000016946
Vega: OTTMUSG00000023867
UniProt: Q8VC57 A0A0R4J000
Position
17; 17 A3.3
AA seq 234 aa
MAENHCELLPPAPSGLGAGLGGGLCRRCSAGMGALAQRPGGVSKWVRLNVGGTYFLTTRQ
TLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEE
GVLEEAEFYNITSLIKLVKDKIRERDSKISQMPVKHVYRVLQCQEEELTQMVSTMSDGWK
FEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTTSEPSEKAKILQERGSRM
NT seq 705 nt   +upstreamnt  +downstreamnt
atggcggagaatcactgcgagctgctgccgccggctccgagcggcctcggggcggggctg
gggggcggcctgtgccgccgctgcagcgctgggatgggcgccctggctcagcgccccggt
ggcgtgtccaagtgggtccggctcaacgtcggcggcacctacttcctcaccacccggcag
acgctgtgccgggacccgaagtctttcctgtaccgcttgtgccaggcggaccccgaccta
gattcggacaaggatgaaacgggtgcctatttaatcgacagagatcccacctactttgga
cctgtactgaactacttgagacatggaaagctggttattaacaaagacctcgcagaggaa
ggagtgttggaagaagcagaattttacaatatcacctcactaataaaacttgtaaaggac
aaaattagagaacgagacagcaaaatatcccagatgccagtgaagcatgtgtaccgtgtg
ctgcagtgccaggaggaggagctcacacagatggtatccacaatgtcagacggctggaag
tttgagcagctggtcagcattggctcctcttacaactatggaaatgaagaccaggctgag
ttcctctgtgtggtttccaaggagctgcacaacactccatacggcacaaccagtgagcca
agcgagaaagccaagattttgcaagaacggggctcaaggatgtga

DBGET integrated database retrieval system