KEGG   Mus musculus (mouse): 69260Help
Entry
69260             CDS       T01002                                 

Gene name
Ing2, 2810011M06Rik, Ing1l, Ing2b, P33ING2
Definition
(RefSeq) inhibitor of growth family, member 2
  KO
K19198  inhibitor of growth protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    69260 (Ing2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     69260 (Ing2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ING PHD zf-RING-like zf-HC5HC2H Med12-PQL PHD_2
Motif
Other DBs
NCBI-GeneID: 69260
NCBI-ProteinID: NP_075992
MGI: 1916510
Ensembl: ENSMUSG00000063049
Vega: OTTMUSG00000017299
UniProt: Q9ESK4
Structure
PDB: 

Position
8; 8 B1.1
AA seq 281 aa AA seqDB search
MLGQQQQQQLYSSAALLTGERSRLLSCYVQDYLECVESLPHDMQRNVSVLRELDNKYQET
LKEIDDVYEKYKKEDDSNQKKRLQQHLQRALINSQELGDEKIQIVTQMLELVENRARQME
LHSQCFQDPAESERASDKSKMDSSQPERSSRRPRRQRTSESRDLCHMTNGIDDCDDQPPK
EKRSKSAKKKKRSKAKQEREASPVEFAIDPNEPTYCLCNQVSYGEMIGCDNEQCPIEWFH
FSCVSLTYKPKGKWYCPKCRGDNEKTMDKSTEKTKKERRAR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgttagggcagcagcagcagcagcagctgtactcgtcggccgcgctcctgaccggagag
cggagccggctgctctcctgctacgtgcaggactacctggagtgtgtggagtcgctgccc
cacgacatgcagaggaacgtgtcggtgctgcgggagctggacaacaaataccaagaaacg
ttaaaggaaattgatgatgtctatgaaaaatataagaaagaagatgattccaaccagaaa
aaacgcctacagcagcatctccagagagcgttaatcaatagccaagaattgggagatgaa
aaaattcagattgtcacccagatgctcgaattggtggagaaccgagcgagacaaatggag
ctgcattcacagtgtttccaggatcctgctgaaagtgagcgagcctcagacaagtcgaag
atggattccagtcaaccggaaagatcttctagaagacctcgaagacagaggaccagtgag
agccgtgacttatgtcacatgacaaacgggattgacgactgtgatgatcaaccaccgaaa
gaaaagagatccaagtccgccaagaagaagaagcgctccaaggccaagcaggagagggag
gcatcccctgtcgagtttgccatcgatcccaatgagcccacctactgcttgtgtaaccaa
gtgtcctacggggagatgataggctgtgacaatgaacagtgtcccattgaatggtttcac
ttttcatgtgtttcactcacctataaacccaaggggaaatggtattgcccaaagtgtagg
ggagacaatgagaaaaccatggacaaaagtaccgaaaagacaaaaaaggagagaagagcg
aggtag

DBGET integrated database retrieval system