KEGG   Mus musculus (mouse): 69263
Entry
69263             CDS       T01002                                 

Gene name
Rfc3, 2810416I22Rik, 38kD, 38kDa, AU022547, Recc, Recc3
Definition
(RefSeq) replication factor C (activator 1) 3
  KO
K10756  replication factor C subunit 3/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    69263 (Rfc3)
   03420 Nucleotide excision repair
    69263 (Rfc3)
   03430 Mismatch repair
    69263 (Rfc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    69263 (Rfc3)
   03036 Chromosome and associated proteins [BR:mmu03036]
    69263 (Rfc3)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    69263 (Rfc3)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    69263 (Rfc3)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     69263 (Rfc3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    69263 (Rfc3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     69263 (Rfc3)
  Check point factors
   HRAD17(Rad24)-RFC complex
    69263 (Rfc3)
SSDB
Motif
Pfam: DNA_pol3_delta2 Rad17 AAA AAA_16 Rep_fac_C AAA_22 ABC_tran ATPgrasp_ST Sigma54_activ_2 DNA_pol3_delta DUF2247 AAA_19 CHB_HEX AAA_5
Other DBs
NCBI-GeneID: 69263
NCBI-ProteinID: NP_081285
MGI: 1916513
Ensembl: ENSMUSG00000033970
Vega: OTTMUSG00000028751
UniProt: Q8R323 Q3TKD1
Position
5; 5 G3
AA seq 356 aa
MSLWVDKYRPSSLARLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELY
GIGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQ
LETSSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCL
AVRVPAPSIEDICSVLSTVCRKEGLALPSTLARRLAEKSCRNLRKALLMCEACRVQQYPF
TEDQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELL
HNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagcctctgggtggacaagtaccggccgagctcccttgcccggctggactatcataag
gaacaggcagcacagctgcgcaacctggtgcagtgtggagactttcctcacctcttagta
tatggaccatcaggtgctggaaaaaagacaagaattatgtgtattctacgtgaactttat
ggtatcggggtggaaaaactgagaattgagcatcagactatcacaaccccgtctaaaaaa
aaaattgaaatcagcaccattgcaagcaactaccaccttgaagttaatcccagtgatgcg
gggaacagcgaccgagttgtaattcaggagatgctgaagacagtggcccagtcacaacaa
cttgaaaccagctcacaaagagacttcaaagtggtattattgacagaggtggacaaactc
acaaaggatgctcagcatgccttacgcagaactatggagaaatacatgtctacctgcagg
ctcatcttgtgctgcaattccacatccaaggtgatacccccgatccgaagcaggtgcctg
gcagttcgtgtgcctgctcccagcatcgaagatatttgcagtgtactatccactgtctgc
aggaaggaaggtctggctctcccttcgacattggcccgtaggctggccgagaagtcatgc
cgaaacctcaggaaagccttacttatgtgtgaggcctgcagagtgcagcaataccctttt
acggaagaccaagaaatcccagagacagactgggaggtgtatctgagggagaccgcaaat
gctattgtcagtcagcagacgccacagaggctccttgaagtccgtggaaggctctatgag
cttctaactcattgtattcctcctgagattataatgaagggcctcctctcagaactcctc
cataactgtgatgggcagctgaaaggggaagtggcacagatggcagcctactatgagcac
cgactacagctgggcagcaaagccatttatcatttggaagcatttgtggcgaagtttatg
gcactttataagaagttcatggaggatggactggaaggcatgatgttctga

KEGG   Mus musculus (mouse): 72151
Entry
72151             CDS       T01002                                 

Gene name
Rfc5, 2610020K06Rik, 2610209F07Rik, 36.5kD, 36.5kDa, 36kD, 36kDa, Recc, Recc5
Definition
(RefSeq) replication factor C (activator 1) 5
  KO
K10756  replication factor C subunit 3/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    72151 (Rfc5)
   03420 Nucleotide excision repair
    72151 (Rfc5)
   03430 Mismatch repair
    72151 (Rfc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    72151 (Rfc5)
   03036 Chromosome and associated proteins [BR:mmu03036]
    72151 (Rfc5)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    72151 (Rfc5)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    72151 (Rfc5)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     72151 (Rfc5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    72151 (Rfc5)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     72151 (Rfc5)
  Check point factors
   HRAD17(Rad24)-RFC complex
    72151 (Rfc5)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_24 AAA_16 AAA_11 AAA_assoc_2 AAA_22 RuvB_N ResIII DNA_pol3_delta AAA_19 DUF815 AAA_14 AAA_5 DEAD PhoH AAA_30 TniB TIP49 AAA_7 ATPase_2 IstB_IS21 AAA_25 Mg_chelatase T2SSE AAA_3 SNF2_N Thioredoxin_6
Other DBs
NCBI-GeneID: 72151
NCBI-ProteinID: NP_082404
MGI: 1919401
Ensembl: ENSMUSG00000029363
Vega: OTTMUSG00000025772
UniProt: Q9D0F6 Q5HZI8
Position
5; 5 F
AA seq 339 aa
MTAAAPSQQRPAAARARNLPWVEKYRPQTLADLISHQDILSTIQKFISEDRLPHLLLYGP
PGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDIVRGPILSFASTRTIFKKGFKL
VILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPEL
MVPRLEHVVQEENVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGH
PLKTDIANILDWMLNQDFTTAYKNIMELKTLKGLALHDILTEVHLFVHRVDFPSSVRIHL
LTKMADIEYRLSVGTSEKIQLSSLIAAFQVTRDLIVAEA
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgacggcggccgcgccttcgcagcagcggcccgcggcggcccgggcccggaacctgccc
tgggttgagaagtaccggccacagaccctggccgatctcatttctcaccaggacattctg
agtaccattcagaagttcatcagtgaagaccgcctgccacacctacttctctatggccct
ccagggacaggaaagacatccaccatcctggcctgtgccaagcaactgtacaaagataaa
gaatttggctccatggtcttggagctgaatgcttctgacgaccgagggatcgatattgtt
cgggggccaatcctcagctttgccagcacaaggacaatcttcaagaaagggtttaagctt
gtgatcctggacgaagccgacgccatgactcaggatgcccagaacgccttgagacgagtg
attgagaagttcacagaaaacaccaggttctgcctcatctgtaactacctgtccaagatc
atccctgccttgcagtctcggtgcacgaggttccgatttggccctctgacacccgagctc
atggtccctcgactggaacatgtagtacaagaagagaatgtggatataagtgaagatgga
atgaaggcccttgtcactctgtccagtggggacatgcgaagggctttgaacatccttcag
agtaccaatatggcctttgggaaggtgacagaggagactgtctacacctgcaccggacac
ccactcaagacggacattgccaatatactggactggatgctcaatcaggacttcaccact
gcctacaaaaacatcatggagctgaagactctgaagggcttggcgctgcatgacatcctg
acagaggttcacttgtttgtacacagagttgactttccatcttcagttcggatacactta
ttgaccaaaatggcagacatcgagtacagactttctgttggcaccagtgagaagatacag
ctgagctccctcatcgccgcttttcaagtcaccagagacctgatagttgcagaggcctag

DBGET integrated database retrieval system