KEGG   Mus musculus (mouse): 69270
Entry
69270             CDS       T01002                                 

Gene name
Gins1, 2810418N01Rik, Gins4, PSF1, Ps, mKIAA0186
Definition
(RefSeq) GINS complex subunit 1 (Psf1 homolog)
  KO
K10732  GINS complex subunit 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    69270 (Gins1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   GINS complex
    69270 (Gins1)
SSDB
Motif
Pfam: Sld5
Other DBs
NCBI-GeneID: 69270
NCBI-ProteinID: NP_081290
MGI: 1916520
Ensembl: ENSMUSG00000027454
Vega: OTTMUSG00000015786
UniProt: Q9CZ15
Position
2; 2 G3
AA seq 196 aa
MFCEKAMELVRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSAGRGDLIP
TVKFRHCALLRNRRCTIAYLYDRLLRIRALRWEYGSVLPNSLRFHMSAEETEWFNHYKKS
LATYMRSLGGDEGLDITQDVKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRW
KCEQLIRQGVLEHVLS
NT seq 591 nt   +upstreamnt  +downstreamnt
atgttctgcgaaaaagctatggagcttgtccgcgagttacaccgcgcgccggaagggcag
ctgccggcctttaatgaggacggactcagacaagttctggaggagatgaaagctttgtat
gaacaaaaccagtctgatgtgaatgaagccaagtcagctggacgaggggatctgatacca
accgtcaaatttcggcactgtgctttgttaagaaatagacgctgcacgatagcatacctg
tatgaccggttgcttcggattagagcactcaggtgggaatatgggagtgtcttgccaaat
agtttacgattccacatgtctgctgaagaaacggagtggttcaaccattataaaaagtct
cttgctacttacatgaggtcgctgggaggagatgaaggcttggacatcacacaagatgtg
aagccccccaaaagcctatatattgaagtgcggtgtttaaaagactatggagaatttgaa
gttgatgatggcacttcagtcctgcttaaaaagaatagtcagcactttttgcctcggtgg
aagtgtgagcagttaatcagacaaggagttctagagcacgtgctgtcctga

DBGET integrated database retrieval system