KEGG   Mus musculus (mouse): 69274Help
Entry
69274             CDS       T01002                                 

Gene name
Ctdspl, 2810418J22Rik, AI426263, HYA22, SCP3
Definition
(RefSeq) CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like
  KO
K15731  carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    69274 (Ctdspl)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    69274 (Ctdspl)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     69274 (Ctdspl)
Protein phosphatases and associated proteins [BR:mmu01009]
 HAD phosphatases
  Fcp/Scp phosphatases
   69274 (Ctdspl)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     69274 (Ctdspl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NIF
Motif
Other DBs
NCBI-GeneID: 69274
NCBI-ProteinID: NP_598471
MGI: 1916524
Ensembl: ENSMUSG00000047409
Vega: OTTMUSG00000038049
UniProt: P58465
Position
9; 9 F3
AA seq 276 aa AA seqDB search
MDGPAIITQVTNPKEDEARSPVAGEKASQRNISLKKQRGRSILSSFFCCFRDYNVEAPPA
NSPSVLPPLVEENGGLQKGDQRQVIPVPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHS
SFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVAD
LLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQS
WFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCSR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggacggtccggccatcatcacccaggtgaccaaccccaaggaggatgaggcccggtcg
cccgtcgcgggcgaaaaagcttcccagcgcaacatcagcctaaagaagcaaaggggtcgg
agcatccttagctctttcttctgctgcttccgagactacaatgtggaagcccctccggcc
aacagccccagtgtgcttccgccactggtggaggagaacggtgggcttcagaagggtgac
cagaggcaggtcattcccgtaccaagcccaccagctaaatacctccttccagaggtgacg
gtgctcgactatggaaagaaatgtgtggtcattgatctagacgaaaccctggtgcacagt
tcgtttaagcccattagtaatgctgacttcattgttcctgttgaaatcgacggaaccata
caccaggtgtatgtgctgaagcgacctcacgtggacgagttcctccagaggatggggcag
ctctttgagtgtgtgctctttactgccagcttggccaagtatgcagaccctgttgccgac
ctcctggaccgctggggtgtgttccgggcccgactcttcagagaatcctgcgtgttccac
cgtgggaactatgtgaaggacttgagtcgcctgggacgggagctgagcaaagtgatcatc
gtggacaattctcctgcctcctacatcttccatcctgagaatgcagtgcccgtgcagtcc
tggtttgacgacatgacagacacggagctgttggacctcatcccgttcttcgagggcctg
agcagggaagacgatgtctacagcatgctgcacagactctgtagcaggtag

DBGET integrated database retrieval system