KEGG   Mus musculus (mouse): 69305Help
Entry
69305             CDS       T01002                                 

Gene name
Dcps, 1700001E16Rik, AA408441
Definition
(RefSeq) decapping enzyme, scavenger
  KO
K12584  m7GpppX diphosphatase [EC:3.6.1.59]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    69305 (Dcps)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    69305 (Dcps)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.59  5'-(N7-methyl 5'-triphosphoguanosine)-[mRNA] diphosphatase
     69305 (Dcps)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA degradation factors
   5'-3' decay
    Other 5'-3' decay factors
     69305 (Dcps)
   3'-5' decay
    Other 3'-5' decay factors
     69305 (Dcps)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DcpS_C DcpS
Motif
Other DBs
NCBI-GeneID: 69305
NCBI-ProteinID: NP_081306
MGI: 1916555
Ensembl: ENSMUSG00000032040
Vega: OTTMUSG00000031937
UniProt: Q9DAR7
Structure
PDB: 

Position
9; 9 A4
AA seq 338 aa AA seqDB search
MADTAPQLKRKREQEAEEAETPSTEEKEAGVGNGTSAPVRLPFSGFRVQKVLRESARDKI
IFLHGKVNEDSGDTHGEDAVVILEKTPFQVEHVAQLLTGSPELKLQFSNDIYSTYNLFPP
RHLSDIKTTVVYPATEKHLQKYMRQDLRLIRETGDDYRTITLPYLESQSLSIQWVYNILD
KKAEADRIVFENPDPSDGFVLIPDLKWNQQQLDDLYLIAICHRRGIRSLRDLTPEHLPLL
RNILREGQEAILKRYQVTGDRLRVYLHYLPSYYHLHVHFTALGFEAPGSGVERAHLLAQV
IENLECDPKHYQQRTLTFALRTDDPLLQLLQKAQQERN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggcggatacagcgcctcaactcaagagaaagcgcgaacaggaggcagaggaggcagaa
acccccagcacagaggagaaggaagcaggcgttggcaatggcacctctgcccctgtccgc
ttaccgttctccggctttagagtacaaaaagtgctcagggagtctgcgcgggacaaaatt
attttcctgcatgggaaggtgaatgaggactctggggatactcatggagaagatgcggtt
gtgatcctggagaagacaccatttcaggtagaacacgtggcgcagctcctaacggggagc
cctgagctcaagttgcagttctccaatgatatctacagcacctataacctgtttcctcca
aggcatctgagtgatataaaaacaactgtggtgtaccctgccacagagaaacacctgcaa
aaatacatgcgtcaggacctccgcctgatccgagagactggagatgactacaggaccatc
accttaccctacctggaatcccagagccttagcatccagtgggtgtataacattcttgac
aagaaggctgaagctgaccggattgtttttgagaacccagacccttctgatggctttgtc
ctcatcccagacctcaagtggaaccagcagcagcttgatgacctgtatttgatcgccatc
tgccatcgccggggtatcagatcacttcgagatctcactccagagcatctgccactactg
aggaacattctccgggaaggacaagaagccatcctgaagcgctaccaggtgacaggagac
cgtctgcgagtgtacctacactacctgccctcttactatcacctgcacgtgcatttcaca
gctctgggcttcgaggctccgggctcaggggtggagcgggcacacctgctggctcaagtg
atcgagaacctggagtgtgaccccaagcactatcaacagcgcactcttacttttgccctc
aggaccgatgaccccctgcttcagctcctgcagaaggcccagcaagagaggaactag

DBGET integrated database retrieval system