KEGG   Mus musculus (house mouse): 69318
Entry
69318             CDS       T01002                                 
Symbol
Fam24b, 1700007K09Rik
Name
(RefSeq) family with sequence similarity 24 member B
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: FAM24
Other DBs
NCBI-GeneID: 69318
NCBI-ProteinID: NP_081313
MGI: 1916568
Ensembl: ENSMUSG00000030858
UniProt: Q9DAL9
Position
7:complement(130927136..130933163)
AA seq 119 aa
MYKPFDLRTIITIIIGCGILTAMFLLIGLVLCLYSKISKALKSPGIAKEADDECYIDPCK
DPHESIILANSIPAEACHSYQANTIAVASCGPLQCCNVCGVYADVNSLPPCLCSIREGL
NT seq 360 nt   +upstreamnt  +downstreamnt
atgtataagccttttgacctccggacaataatcacgatcatcattggttgcgggatcctg
acagccatgtttctactgataggacttgtgctttgtctttactccaaaatatccaaggct
ctgaagtcccctggaatcgcaaaggaggcagatgatgaatgctatattgatccatgcaag
gacccccatgagagcatcatcctggccaacagcatccctgctgaggcttgtcattcctac
caggccaacaccattgctgttgcgagttgcggtcccctccagtgttgtaatgtatgtggt
gtctatgcagatgttaactccctgccaccctgcctttgtagcataagggaaggactctga

DBGET integrated database retrieval system