KEGG   Mus musculus (house mouse): 69329
Entry
69329             CDS       T01002                                 
Symbol
Cfap206, 1700003M02Rik
Name
(RefSeq) cilia and flagella associated protein 206
  KO
K25471  cilia- and flagella-associated protein 206
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    69329 (Cfap206)
Cilium and associated proteins [BR:mmu03037]
 Motile cilia and associated proteins
  Other motile cilia associated proteins
   69329 (Cfap206)
SSDB
Motif
Pfam: FAP206
Other DBs
NCBI-GeneID: 69329
NCBI-ProteinID: NP_001333991
MGI: 1916579
Ensembl: ENSMUSG00000028294
UniProt: Q6PE87
Position
4:complement(34688574..34730263)
AA seq 622 aa
MPPTQAESVIKNIIREIGQECAAHGEIASETVVAFMVKAVVLDPSNGFNMDRTLIKTDVQ
KLVKLCVARLLDNKNPSLDTIKMQVYFDMNYTSREDFLEEHHRVLESRLGIVSREITDNR
ASAREELENLYRKIVSYVLLRSGLGSPTDIKIVREATAALQSVFPQAELATFLTLSKKDK
ERQLKELTMIVTGIRLFNRDCGKGGEGIDDLPAILHEAIPTTTQHIDSQLQIAQDQAFRY
TAILEKVTNNPLMAKELQPYMLKEALYNVRQYEIFLQTVLSDIITCAEEVEMMIKQLAAQ
LEQLKMAVKSKTAVPTSQVFPIFVALASLWMSFQDETVLISVLSNLTTNLELFLGTHELL
FPEKVMLGLLDGVVVKSDLTRIEEHMEERVELADFRTQEWLFPETTANFNKLLIQYRGFC
GYTFAVTDGLLLPGNPAIGILKYKEKYYTFSTRDAAYTFAENPDHYIHLIKEKAKKNAEL
IQLLELHQQFETLIPYSQMRDVDKHYIKPITKCDNGTQTDTHILPPTTMRTYEWNEWELR
RKAIKLANLRQKITHSVQTDLSHMRRDNTSQVYPLKEASTQSKREGSSRVPRPQIFIAGL
RGGQSKTTYGVKVNLTRAVDET
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgcctcccactcaagcagaaagtgtgataaagaatatcatacgagaaataggacaagaa
tgtgcagcccacggagagatcgcttcagagacggtggttgcttttatggtgaaagctgtc
gtcctagatcccagcaatggctttaacatggataggaccctcatcaagactgacgtgcag
aaacttgttaagctttgtgtggcacggctactggacaataaaaatccatccctggacacc
attaagatgcaggtctactttgatatgaactatacaagtcgagaggactttcttgaagaa
catcaccgggtcttagaatccaggttaggcattgttagcagagaaatcacagacaacaga
gcaagtgctagggaagagctggaaaatctctacagaaagatcgtcagctacgtgctcctg
cgctctgggcttggatcccccacagacatcaagattgtcagagaggcaacagccgctctg
cagagcgttttccctcaggctgagctcgccacgtttctgaccctcagtaagaaggacaaa
gagcgccagttgaaagagctcaccatgattgttaccggaattcgcttatttaacagagac
tgtggaaaaggaggagaaggcattgatgatttgccggccattctccacgaagcgatccca
accaccacacagcacatagactcccagcttcagattgcccaggaccaggcgtttcgctac
acggccatccttgagaaagtaaccaacaaccccctcatggccaaagaactccagccgtat
atgttaaaggaagcactgtacaatgttcggcagtatgagatcttcctgcagactgttttg
tcagatataattacttgtgctgaggaagtagagatgatgataaaacaattagcagcccaa
ctggaacaactgaaaatggcagtaaaatctaagacggcggtcccaacatcccaagtcttc
cccatcttcgttgcgctggcgagtctgtggatgagcttccaggacgagacggttctgatc
agcgttctcagtaacttgaccaccaacctggagctcttcctgggcacccacgagctcctc
tttcccgagaaagtgatgctagggcttctcgatggcgtcgtcgtgaaaagcgatttgacg
aggatagaggaacacatggaagaaagagtggagttggcagatttcagaacacaggaatgg
ctttttccagaaacaacagcaaactttaacaaactgttaattcagtatcgtggattttgt
ggctacacatttgctgtgactgatggccttctcctcccaggaaatccagccattggaatt
ttgaaatacaaagaaaaatattatactttcagtaccagagatgctgcatacacattcgca
gaaaatccagaccattacatccatttgattaaggagaaagccaagaagaatgcagagtta
attcagctactagaacttcatcagcagtttgaaactctcataccctattctcagatgaga
gatgttgacaagcattatataaagccaattacaaagtgtgacaacggcacacagacagat
acacacatattgccacccacgaccatgagaacatatgagtggaacgaatgggaactaaga
agaaaagccataaaactggctaatttgcgccagaaaattactcactccgtccagactgac
cttagccacatgagaagagataacacctcacaggtgtaccctttgaaagaggctagcacc
cagtccaagagagaaggcagcagccgagtgcccaggccccagattttcatagctggcctt
cgtgggggacaaagcaaaacaacctatggggtgaaggtgaacttaaccagagcggtggac
gaaacctag

DBGET integrated database retrieval system