KEGG   Mus musculus (house mouse): 69352
Entry
69352             CDS       T01002                                 
Symbol
Necab1, 1700003H21Rik, Efcbp1, STIP-1
Name
(RefSeq) N-terminal EF-hand calcium binding protein 1
  KO
K23854  N-terminal EF-hand calcium-binding protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    69352 (Necab1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  Calcium binding proteins
   69352 (Necab1)
SSDB
Motif
Pfam: ABM EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 MRP-L28 Rep_N RraB
Other DBs
NCBI-GeneID: 69352
NCBI-ProteinID: NP_848732
MGI: 1916602
Ensembl: ENSMUSG00000040536
UniProt: Q8BG18
Position
4:complement(14952245..15149804)
AA seq 352 aa
MEDSRETSPSSNNSSEELSSTLQLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVL
SGEELHELFHTIDTHNTNNLDTEELCEYFSQHLGEYENVLAALEDLNLSILKAMGKTKKD
YQEASNLEQFVTRFLLKETLNQLQSLQNSLECAMETTEEQTRQERQGPSKPEVLSIQWPG
KRSSRRVQRHNSFSPNSPQFNVSSPALLEEDNQWMTQINRLQKLIDRLEKKDLKLEPLEE
EIIEENTKPHIMLVQRQMSVTEEDLEEFQLALKHYVESASAQSGCLRISIQKLSNESRYM
IYEFWENSSVWNRHLQTNYSKTFQRSNVDFLETPELTSTMLVPASWWILNNN
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggaggattcccgggagacttcgccttcctccaacaactcctcggaagagctcagctct
accctgcaactgtccaagggcatgtccatcttcctcgacattctgaggagagcagacaaa
aatgatgatggaaaattgtcctttgaggaatttaaagcatattttgcagatggagttctc
agtggagaagaactacatgagctcttccacaccattgacacacacaataccaacaatctc
gacacagaagaactatgcgaatatttttctcagcacttgggtgaatatgagaatgtactg
gccgcacttgaagacctgaatctctccatcctgaaggcaatgggcaagacaaagaaagac
taccaagaagcttccaatttggaacaatttgtcactcgatttttgttgaaggagaccttg
aatcagttgcagtctctccagaactctctggaatgtgccatggaaactactgaagagcaa
acgcgtcaagaaaggcaaggaccatccaagccagaagtcctgtccattcaatggcctgga
aagcgatccagccgccgagtccagagacacaatagtttctcccccaacagcccgcagttc
aatgtcagcagtccagcattgttagaagaagacaaccagtggatgacccagataaacaga
ctccagaaattaattgatagactggaaaagaaggatctgaaacttgaacccctggaagaa
gaaattattgaagagaacactaaacctcacatcatgcttgtgcagcgccagatgtctgtg
acagaagaggatctggaagaattccagcttgctctgaagcactatgtggagagtgcttca
gctcaaagtggatgcctgcgtatctctatacagaagctctcaaacgaatctcgctacatg
atttatgagttctgggagaacagcagtgtgtggaaccgccacctccagacgaattacagc
aagacgttccaaagaagcaacgtggatttcttggaaactccagagctcacatctaccatg
ctagttcctgcttcatggtggatcctgaacaacaattag

DBGET integrated database retrieval system