KEGG   Mus musculus (mouse): 69363
Entry
69363             CDS       T01002                                 

Symbol
Spaca4, 1700008E09Rik, AV043694, Samp14
Name
(RefSeq) sperm acrosome associated 4
  KO
K19894  sperm acrosome membrane-associated protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    69363 (Spaca4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Receptors
  69363 (Spaca4)
SSDB
Motif
Pfam: UPAR_LY6 Squash Activin_recp UPAR_LY6_2
Other DBs
NCBI-GeneID: 69363
NCBI-ProteinID: NP_081331
MGI: 1916613
Ensembl: ENSMUSG00000070563
Vega: OTTMUSG00000033718
UniProt: Q80ZQ0
Position
7:complement(45374531..45375240)
AA seq 127 aa
MVLGWPLLLVLVLCPGVTGIKDCVFCELTDSARCPGTHMRCGDDEDCFTGHGVAQGVGPI
INKGCVHSTSCGREEPISYMGLTYSLTTTCCSGHLCNKGTGLSTGATSLSLGLQLLLGLL
LLLQYWL
NT seq 384 nt   +upstreamnt  +downstreamnt
atggtccttggctggccactgcttctggtgttggttctttgcccaggtgtgacaggcatc
aaggactgcgtcttctgtgagctgactgactctgctcggtgccctggcacacacatgcgc
tgtggggatgacgaagattgcttcacaggccacggagtagcccagggtgtggggcccatc
atcaacaaaggctgcgtgcactccaccagctgtggccgcgaggaacccatcagctacatg
ggcctcacatacagtctcaccaccacctgctgttctggccacctttgcaataagggcact
ggcctttccacaggggctaccagcctgtcactgggtctgcagctgctcctgggcctgttg
ctgctgcttcaatactggctgtga

DBGET integrated database retrieval system