KEGG   Mus musculus (house mouse): 69376
Entry
69376             CDS       T01002                                 
Symbol
Zpbp2, 1700017D11Rik, 2610022C02Rik, ZPBPL
Name
(RefSeq) zona pellucida binding protein 2
  KO
K25752  zona pellucida-binding protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    69376 (Zpbp2)
SSDB
Motif
Pfam: Sp38
Other DBs
NCBI-GeneID: 69376
NCBI-ProteinID: NP_081337
MGI: 1916626
Ensembl: ENSMUSG00000017195
UniProt: Q6X786 Q5FWC7
Position
11:98441923..98449491
AA seq 326 aa
MLAWALLYAVLWSLAGVGSQRSSLFNIKGFVYGTVGHPVKIYVKLHQASPVLICMDIDRA
NKETVDPTYLWTGPNENTLKGNSQINITNTGELVLKDFLEPLSGLYSCMLSYKTIKAETQ
EETMIKKKYDFLVFAYREPDYSYHMAVRFTTGSCVGRHNDLLFRVLKKILDNLISDLLCH
VIEPSYKCHFVKLPERDFLYELFIAFQVNPFAPGWRSLCNRSADCEDITNHNVLKARDRM
EEFFRKQAHILHHHFNRTVPAMHFVDHSFQVTRIDNCRPGFGKNEGLHSNCATCCVVCSP
GTFSPDVDVTCQICVSVHIYGAKACP
NT seq 981 nt   +upstreamnt  +downstreamnt
atgcttgcgtgggccctactctacgcggtgctctggtctctcgcaggagttggatcgcaa
cgttcttccttattcaatatcaaaggctttgtttacggcacggtagggcacccagtaaaa
atatatgtaaagttacatcaggctagtcctgtccttatttgtatggatattgatcgtgcc
aataaagaaacagtggaccccacctatttatggactgggccaaatgaaaacacattaaaa
gggaatagccagataaatataacaaacacaggagaactggtactgaaggatttcctggag
ccgttatctggactttactcatgtatgctttcctataagactatcaaagcagaaacccaa
gaagaaactatgataaagaagaaatatgactttctggtctttgcatatcgggaacctgat
tattcttaccacatggccgtgcgttttaccacaggatcttgtgtaggaagacacaatgac
ctgctctttagagtgctgaagaaaatcttggataacttaatctctgatttattgtgccat
gtcatagagccatcatacaaatgccattttgttaaacttccagagagggacttcctgtat
gagctgttcatagcctttcaagtgaatcctttcgcaccgggctggagaagtttgtgcaac
cgctctgctgactgtgaagacatcacgaatcacaacgtcctcaaggcgagagatcggatg
gaagaattttttcggaaacaagcacacattctacaccatcacttcaacagaacggtccca
gctatgcactttgtggaccacagttttcaagtaacacggatagacaattgtcgaccaggc
tttgggaaaaacgaaggtctgcacagcaattgtgctacctgttgcgtggtctgtagtcct
ggaacgttcagtcccgatgtggatgtcacctgtcagatctgtgtttctgtccatatctat
ggagctaaagcttgcccataa

DBGET integrated database retrieval system