KEGG   Mus musculus (mouse): 69408Help
Entry
69408             CDS       T01002                                 

Gene name
Dnajc17, 1700025B16Rik, C87112, D9Bwg1371e
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C17
  KO
K09537  DnaJ homolog subfamily C member 17
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    69408 (Dnajc17)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   69408 (Dnajc17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 69408
NCBI-ProteinID: NP_631878
MGI: 1916658
Ensembl: ENSMUSG00000034278
Vega: OTTMUSG00000015761
UniProt: Q91WT4
Position
2 E5; 2 59.97 cM
AA seq 303 aa AA seqDB search
MAVTKELLQMDLYALLGIEEKAADKEVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQAL
EVLTDAAARAAYDKVRKAKKQAAERTQRLDENRKKVKLDLEARERQAQAHGSEEEEESRS
ATTLEQEIARLREEGSRQLEEQQRLIQEQIRQDREQRLRGRTENTEGKGTPKLKLKWKCK
KEDESQGGYSRDVLLRLLQKYGEVLNLVLSRKKAGNAIVEFATVRAAELAVRNEVGLADN
PLKVSWLEGQPQSTVDPGPPGLSKGSVLSERDFESLVMMRMRQAAERQQLIAQMQQEDEG
RPT
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaccaaagagctcttacaaatggatctgtacgcgctgctcggcattgaggag
aaggcggcagacaaagaggtgaagaaggcgtacaggcaaaaagcactatcctgccaccca
gacaaaaatccagataaccccagagcagctgaactcttccaccagctgtcccaggccttg
gaagtgctgacggatgctgcagccagggctgcatatgacaaggttaggaaagccaagaag
caggcagcagagaggacccagagacttgacgagaacaggaagaaagtgaaacttgatctg
gaggccagggagcggcaggcccaggcccatgggagtgaggaagaggaggagagcaggagc
gccaccacactagagcaggagattgctcgacttcgagaagagggttcccgtcagttggaa
gagcagcagaggctgatccaggagcagatccgccaggaccgagaacagaggctgagagga
agaacagaaaatactgaaggcaaaggaacccccaaactaaagctaaagtggaagtgcaag
aaggaggatgagtcccaaggtggctactccagagatgtcctcctgaggcttttacagaag
tatggggaggttctcaacctggtactttccagaaagaaggcaggcaatgccatagtggag
tttgcaactgtcagagctgcggagctggctgtcagaaatgaagtgggcctggctgacaac
cctctgaaggtttcctggttggagggacagccccagagcacagtggaccccggcccccca
ggactgtcaaagggctcagtgctgtcagaaagggactttgagagtctcgtcatgatgcgc
atgcgccaggcagctgagcgccagcagctgattgcccagatgcagcaggaagatgagggg
cggcccacgtag

DBGET integrated database retrieval system