KEGG   Mus musculus (mouse): 69454
Entry
69454             CDS       T01002                                 

Gene name
Clic3, 2300003G24Rik
Definition
(RefSeq) chloride intracellular channel 3
  KO
K05023  chloride intracellular channel protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    69454 (Clic3)
Ion channels [BR:mmu04040]
 Chloride channels
  Chloride channel, intracellular (CLIC)
   69454 (Clic3)
SSDB
Motif
Pfam: GST_C_2 GST_N_3 GST_N_2 GST_C Glutaredoxin GST_N_4
Other DBs
NCBI-GeneID: 69454
NCBI-ProteinID: NP_081361
MGI: 1916704
Ensembl: ENSMUSG00000015093
Vega: OTTMUSG00000012117
UniProt: Q9D7P7
Position
2; 2 A3
AA seq 237 aa
MAETTKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRALDVLKDFAPG
SQLPILLYDGDVKTDTLQIEEFLEETLGPPDFPSLAPRYRESNTAGNDIFHKFSAFIKNP
VPTQDNALYQQLLRALTRLDSYLRAPLDHELAQEPHLRESHRRFLDGDQFTLADCSLLPK
LHIVDTVCAHFRQLPIPAELSCVRRYLDSALQKKEFKYTCPHSAEILAAYQPAVHPR
NT seq 714 nt   +upstreamnt  +downstreamnt
atggctgaaaccaccaagctccagctctttgtgaaggccagtgaggatggcgagagcgta
ggacactgcccttcctgtcagcggctcttcatggtcctactcctcaagggtgtgcccttc
acactcaccacagtggacactcgaagggcattggatgtgctgaaggacttcgcaccaggc
tcacagctgcccatcctgctgtacgatggggatgtcaagacagacacactgcagatcgag
gagtttctggaggagacgttggggccacctgacttccctagcctggcacccaggtacagg
gagtccaacacagcgggcaatgacatcttccacaagttctctgccttcatcaagaaccca
gtgcctacacaggacaatgccctgtatcagcagctgctccgggccctgaccaggctggac
agctacctgcgtgcaccactggaccacgaactggcacaggagccacatcttcgtgagtcc
caccgccgctttctcgatggtgaccagttcacgttggctgactgcagtctactacccaag
ctgcacattgtggataccgtgtgtgcacacttccgccagctgcccatccccgcggaactg
tcctgcgttcgtcgctacttggacagtgcgttgcagaagaaggagttcaagtatacgtgt
ccacacagcgcagagatcctggctgcctaccagcctgctgtgcacccccgttag

DBGET integrated database retrieval system