KEGG   Mus musculus (mouse): 69462Help
Entry
69462             CDS       T01002                                 

Gene name
Slurp2, 2300005B03Rik, SLURP-2
Definition
(RefSeq) secreted Ly6/Plaur domain containing 2
  KO
K23682  secreted Ly-6/uPAR-related protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    69462 (Slurp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPAR_LY6 Toxin_TOLIP
Motif
Other DBs
NCBI-GeneID: 69462
NCBI-ProteinID: NP_001075430
MGI: 1916712
Ensembl: ENSMUSG00000075605
Vega: OTTMUSG00000045145
UniProt: P0DP59
Position
15; 15 D3
AA seq 97 aa AA seqDB search
MRLPFWFLLAVVLSMELAVTQGLQCHLCKGFGGCSRPSSCPWSSTHCVIIATRSPISFTD
LPLVTKMCYSGCPDVSSLGLGPHVSIACCQSNLCNRD
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttcccttctggttccttctggccgtggtcttgagcatggagctagctgtaaca
cagggcctgcaatgccacctgtgcaagggatttggaggatgctctcgcccgtctagctgc
ccatggagctccacccactgtgtcatcattgccacccgttctcccatcagctttacagat
ctgcctctggtgacgaagatgtgctacagtggctgtcctgatgtctccagcttgggctta
ggtcctcatgtatccatcgcctgctgccagtccaatctctgcaacagggactga

DBGET integrated database retrieval system