KEGG   Mus musculus (mouse): 69470Help
Entry
69470             CDS       T01002                                 

Gene name
Tmem127, 2310003P10Rik, AI314202, AI317350
Definition
(RefSeq) transmembrane protein 127
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 69470
NCBI-ProteinID: NP_780354
MGI: 1916720
Ensembl: ENSMUSG00000034850
Vega: OTTMUSG00000016014
UniProt: Q8BGP5
Position
2 F1; 2 61.87 cM
AA seq 238 aa AA seqDB search
MYAPGGAGLPGGRRRRSPGSSALPKQPERSLASALPGALSITALCTALAEPAWLHIHGGT
CSRQELGVSDVLGYVNPDLLKDFCMNPQTVLLLRVIAAFCFLGILCSLSAFLLDVFGPKH
PALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQQHKKYHGSQVYVTFAVSFYLV
AGAGGASILATAANLLRHYPTEEEEQALELLSEMEENDPYPAEYEVINQFQPPPAYTP
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcccctggaggtgccgggctgccgggagggcgccggcggagaagcccgggaagc
agcgctcttcccaagcagccggagcggagcctggcctcggccctgcctggcgccctgtcc
atcacagcgctgtgcactgccctcgcggagcccgcttggttgcacatccatggaggcacc
tgttcccgccaggagctgggggtctcggacgtgctgggctatgtaaacccggatctgcta
aaagatttctgcatgaacccccagacagtgctgctcctgagggtcatcgctgctttctgc
ttcctgggcatcctgtgtagtctctctgcattccttttggatgtctttgggcccaagcat
ccagctctgaagattactcgtcggtatgcctttgctcacatcctcactgtcctacagtgt
gctaccgtcattggcttttcctattgggcttctgagctcatcctggcccagcagcaacag
cataagaagtaccacggctcccaagtctatgtcacctttgctgttagcttctacttggtg
gcaggagctggtggagcctcaatcctggctactgcagccaacctcctgcgccactaccca
acagaggaagaagaacaagcactggagctactatctgagatggaggagaatgacccctac
ccagcagagtatgaggtcatcaaccaattccagccaccccctgcctatacaccctaa

DBGET integrated database retrieval system