KEGG   Mus musculus (house mouse): 69482
Entry
69482             CDS       T01002                                 
Symbol
Nup35, 2310006I24Rik, 35kDa, 5330402E05Rik, MP44, NO44
Name
(RefSeq) nucleoporin 35
  KO
K14313  nuclear pore complex protein Nup53
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    69482 (Nup35)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    69482 (Nup35)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    69482 (Nup35)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     69482 (Nup35)
SSDB
Motif
Pfam: Nup35_RRM Nup35_RRM_2
Other DBs
NCBI-GeneID: 69482
NCBI-ProteinID: NP_081367
MGI: 1916732
Ensembl: ENSMUSG00000026999
UniProt: Q8R4R6
Structure
Position
2:80469156..80490415
AA seq 325 aa
MAAFAVDPQAPTLGSEPMMLGSPTSPKTGANAQFLPGFLMGDLPAPVTPQPRSISGPSVG
VMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQANISLLQ
SPLVGATTPVPGQSMFSPANIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDTWVTVFGF
PQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVK
PCIDKNVMENSDRGVLSSPSLAFTTPIRTLGTPTQSGSTPRVSTMRPLATAYKASTSDYQ
VISDRQTPKKDESLVSRAMEYMFGW
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcagcgtttgcggtggatccccaggcgcccacgttgggatctgaaccaatgatgttg
ggttcacctacatctccaaagacaggcgctaatgcccagttcttgcctggatttttaatg
ggggatctaccagctccagtgactccgcaacctcgatcaattagtggcccttcagtagga
gtaatggaaatgagatcacctttactagcagggggctccccaccacagccagttgtccct
gctcataaagataagagtggagctccacctgtgagaagtatctatgatgacatttccagc
ccaggacttggatcaacgcctttgacttcaagaagacaggcaaacatttcattgttgcag
agtcctcttgttggagctacaactcctgtacctgggcaaagcatgtttagtccagcaaac
attggtcaaccacgaaagacaacactatctcctgcccaactggatcctttttatactcaa
ggagattctctgacttcagaagatcacctagatgacacttgggtgactgtgtttgggttt
ccacaggcatctgcttcttatatattattacagtttgcacaatatgggaatatcttaaag
catgtgatgtctaacacaggcaactggatgcatattcgttaccaatctaaattgcaagcc
cggaaagccttaagcaaagacgggagaatatttggagaatccatcatgattggtgtcaag
ccatgtatagataaaaatgtcatggaaaacagtgacagaggagtcttgtcatctccatct
ctagcctttacaacacccatcaggactttaggcactccaacacagtccggaagcactcct
agggtttctaccatgaggcctcttgccacagcatacaaggcctccactagtgactaccag
gttatttctgacagacagacaccaaagaaggatgagagccttgtgtcaagagcgatggag
tacatgttcggttggtag

DBGET integrated database retrieval system