KEGG   Mus musculus (mouse): 69511
Entry
69511             CDS       T01002                                 

Symbol
Klk12, 2310008B01Rik, AI324852, KLK-L5
Name
(RefSeq) kallikrein related-peptidase 12
  KO
K09621  kallikrein 12 [EC:3.4.21.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    69511 (Klk12)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     69511 (Klk12)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   69511 (Klk12)
SSDB
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 69511
NCBI-ProteinID: NP_081373
MGI: 1916761
Ensembl: ENSMUSG00000044430
Vega: OTTMUSG00000022522
UniProt: B2RVZ0
Position
7:43418315..43423005
AA seq 247 aa
MRFSILLLLCAVGLSQADREKIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKWVLTA
AHCRDKYVVRLGEHSLTKLDWTEQLRHTTFSITHPSYQGAYQNHEHDLRLLRLNRPIHLT
RAVRPVALPSSCVTTGAMCHVSGWGTTNKPWDPFPDRLQCLNLSTVSNETCRAVFPGRVT
ENMLCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI
RIVIRNN
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaggttcagcattctcttgctcctgtgtgctgtgggtctcagtcaggcagacagggag
aagatctataatggtgtcgagtgtgtgaagaactcacagccttggcaggtggggctgttc
catggcaaatacctgcgctgtggcggtgtccttgtggaccgcaagtgggtccttacggct
gctcactgccgtgacaagtacgtggtgcgccttggggaacacagcctcaccaagctggac
tggacagaacagttgagacacaccaccttctccataacacaccccagctaccagggcgcc
tatcagaaccatgagcatgatcttcgactcctgcggctgaacagacccatccacctgacc
cgtgctgtccggcccgtggccctgcccagttcctgtgtaactacaggggccatgtgtcat
gtctcaggatggggtactacaaacaagccatgggacccattcccagaccggctccagtgc
ctcaacctctccactgtctccaatgagacgtgccgggctgtgtttcctggaagagtgacg
gagaatatgttgtgtgcaggtggagaagccgggaaggatgcctgtcagggtgactctgga
ggccccctggtgtgtggaggggttcttcaaggtctggtttcctggggatctgttgggcct
tgtggtcaaaaaggtattccaggagtctacacgaaggtctgcaaatacacggactggatc
agaatagtcatcaggaataactaa

DBGET integrated database retrieval system