KEGG   Mus musculus (mouse): 69527
Entry
69527             CDS       T01002                                 

Gene name
Mrps9, 2310002A08Rik, AW322516, Mrp-S9, S9mt, mg637
Definition
(RefSeq) mitochondrial ribosomal protein S9
  KO
K02996  small subunit ribosomal protein S9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    69527 (Mrps9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    69527 (Mrps9)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    69527 (Mrps9)
  Bacteria
    69527 (Mrps9)
  Archaea
    69527 (Mrps9)
SSDB
Motif
Pfam: Ribosomal_S9 Longin
Other DBs
NCBI-GeneID: 69527
NCBI-ProteinID: NP_076003
MGI: 1916777
Ensembl: ENSMUSG00000060679
Vega: OTTMUSG00000046302
UniProt: Q9D7N3
Position
1; 1 B
AA seq 390 aa
MAAPCVSCGRVLSLWFTPAVRASLCQRPGYWTASAVGWQTGTRFQLSKLIHTTVVTTKKN
VQASRQESYTEDFIKKQIEEFNIGKRHLANMMGEDPETFAEEDIDRAIAYLFPSGLFEKR
ARPMMKHPEHIFPKQRATQWGEDGRPFHFLFYTGKQSYYSLMHDVYGKVMQLEKHRGPLS
ASAESRDLIGSRWLIKEELEEMLVEKLSDEDYAQFIRLLEKLLTLPCGPAEEEFVQRFRR
SVTIQSKKQLIEPVQYDEQGMAFSTSEGRRKSATAQAVVYEHGSGKIHVNGVDYLIYFPI
TQDREQLMFPFHFLDRLERHDVTCTVSGGGRSAQAGAIRLAMARALCSFVTEDEVEWMRQ
AGLLTPDPRIRERKKPGQEGARRKFTWKKR
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggccgccccctgtgtgtcctgcggccgagtgctttccctttggttcactcccgctgtt
agagctagcctctgccagaggcccgggtactggacagcctcggcggttggctggcagaca
gggaccaggttccagctatcaaagctaatacataccacagttgtaacaacaaagaaaaat
gtccaagcctcaagacaggaatcatatacagaagattttattaaaaagcagattgaagaa
ttcaatatagggaagaggcacttagccaacatgatgggagaagacccggaaacttttgct
gaagaggatattgatagagctattgcttacctttttccaagtggtttgtttgagaagcga
gccaggccaatgatgaagcatcctgaacatatttttccaaaacaaagagcaacccagtgg
ggagaagatggccgtccatttcattttctcttctatactggcaaacaatcgtactattca
ttaatgcacgacgtgtatggaaaggtcatgcagctggaaaagcacagagggccactgtcg
gcaagcgctgagtccagagacctgattggcagcagatggctgattaaggaggaactagaa
gaaatgttagtggaaaaactgtcagatgaagattatgcacagttcatccgactgctcgag
aagctattgacattgccgtgcgggcctgcagaagaagaatttgtgcagaggttccgcaga
agtgtaactattcaatcaaaaaagcaactgattgaacccgtgcagtatgacgagcagggc
atggccttcagcaccagcgaaggccggaggaagagcgccacggcacaggcggtcgtttat
gagcacggaagcgggaagatccacgtgaacggagttgattatctaatttactttcccatc
acacaggacagagaacagttgatgttccctttccacttcctggaccggctggagagacac
gatgtgacctgcacagtctccgggggagggaggtcagcgcaggcaggcgccatacgcttg
gcgatggccagagctttgtgcagcttcgtcactgaggatgaggtcgagtggatgagacaa
gccggactacttacccctgatcctcggatcagagaacggaagaagccaggccaggagggt
gctcgaagaaagttcacctggaagaagcgctga

DBGET integrated database retrieval system