KEGG   Mus musculus (house mouse): 69539
Entry
69539             CDS       T01002                                 
Symbol
Trnp1, 2300002D11Rik, Trnp
Name
(RefSeq) TMF1-regulated nuclear protein 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Syntaxin DUF3335
Other DBs
NCBI-GeneID: 69539
NCBI-ProteinID: NP_001074625
MGI: 1916789
Ensembl: ENSMUSG00000056596
UniProt: Q80ZI1
Position
4:complement(133218408..133226446)
AA seq 223 aa
MPGCRISACGPGAQEGTAEPGSPPPPPREPLPSLQPPSPSPTSTPTPTKSPPLPEAAETP
VEGQELQRWRQGASGGSGGAGPAGIAGAAAGAGGRALELAEARRRLLEVEGRRRLVSELE
SRVLQLHRVFLAAELRLAHRAESLSRLSGGVAQAELYLAAHGSRLKKGARRGRRGRPPAL
LASALGLGSCVPWGAGRLRRGQGPEPDSPFRRSPPRGPASPQR
NT seq 672 nt   +upstreamnt  +downstreamnt
atgccgggctgccgaatcagcgcctgcggcccaggggcccaggaagggacggcagaaccg
gggtcgcccccgccgccaccccgggagcccctgccgtccctccagcccccttccccatcg
ccgacctcgactccgacccccactaagtcaccgcccttacccgaggcggccgagacaccc
gtggaagggcaggagctgcagcgctggcgccagggtgctagtggggggtctgggggcgcg
ggcccggcggggatcgcgggcgcggcggcgggggcagggggccgtgcgctggagctggcc
gaagcgcggcggcgactgctagaagtggagggccgccggcgcctggtgtcggagctggag
agccgggtgctgcagctgcaccgagtcttcttggctgcggagctgcgcctggcgcatcgc
gccgagagcctgagccgcctgagcggcggcgtggcccaggccgagctctacctggctgcg
cacgggtcccgtctcaagaagggtgcgcgccgcggtcgccggggtcgtcccccggcgctg
ctggcgtccgcgctcggcctggggagctgcgtgccctggggcgcagggcggctacggcgc
ggccagggcccggagcccgactcgcccttccgccgcagcccgccccgcggccccgcctcc
ccccagcgctga

DBGET integrated database retrieval system