KEGG   Mus musculus (mouse): 69540
Entry
69540             CDS       T01002                                 

Symbol
Klk10, 2300002A13Rik, NES1, PRSSL1
Name
(RefSeq) kallikrein related-peptidase 10
  KO
K09619  kallikrein 10 [EC:3.4.21.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    69540 (Klk10)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     69540 (Klk10)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   69540 (Klk10)
SSDB
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 69540
NCBI-ProteinID: NP_598473
MGI: 1916790
Ensembl: ENSMUSG00000030693
Vega: OTTMUSG00000058309
UniProt: Q99M20
Position
7:43430478..43434834
AA seq 278 aa
MRVPLLHLSTASGSWSLVKLLLPLLMVQLWAAQALLLPGNATRVDLEASGAQCERDYHPW
QVSLFHNLQFQCAGVLVDQNWVLTAAHCWRNKPLRARVGDDHLLLFQKEQLRSTSSPVFH
PKYQACSGPILPHRSDEHDLMMLKLSSPVMLTSNVHPVQLPFRCSQPGQECQVSGWGTSA
SRRVKYNRSLSCSKVTLLSQKQCETFYPGVITNSMICAEADGNQDSCQSDSGGPLVCDDT
LHGVLSWGIYPCGAAQHPSVYSEICKYTPWIRRVIRFK
NT seq 837 nt   +upstreamnt  +downstreamnt
atgagggtcccgcttcttcacctctccactgcctctggctcctggtccctggtgaagctt
ctgctgccgctactgatggtgcaactctgggcggcgcaggctctgctgctcccgggaaac
gccacgcgcgtggacctcgaggcctccggcgcccagtgcgagcgtgactatcatccctgg
caggtctccctcttccataacctccagttccaatgtgcgggtgtcctggtggaccagaac
tgggtgctcacggccgcacattgctggagaaataagccactgagagctcgagttggcgat
gaccacttgctgcttttccagaaggagcaactgcggtccacgagttcacctgttttccac
cccaagtatcaggcttgctcaggccccatcctgccacatcgctcagatgaacacgacctc
atgatgctgaaactgagcagtcctgtaatgctgacgtccaacgtgcatcccgtgcaactg
cccttccgctgctctcagccagggcaagagtgtcaggtctcaggctgggggacctcagcc
agccgaagagtgaagtacaataggagcctgagctgttccaaggtaactctccttagccag
aagcagtgtgagaccttctacccaggtgtgatcaccaacagcatgatttgtgctgaggca
gacggaaaccaagactcttgccagagtgactccggtggccccctggtgtgtgatgacacc
ctgcatggcgtcctctcgtggggcatttacccatgtggtgctgcccagcacccatctgtc
tactcagagatctgcaaatacaccccctggatccgaagagtcattcgtttcaaatga

DBGET integrated database retrieval system