KEGG   Mus musculus (mouse): 69562Help
Entry
69562             CDS       T01002                                 

Gene name
Cdk13, 2310015O17Rik, Cdc2l5
Definition
(RefSeq) cyclin-dependent kinase 13
  KO
K08819  cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    69562 (Cdk13)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     69562 (Cdk13)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     69562 (Cdk13)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   69562 (Cdk13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Kdo Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 69562
NCBI-ProteinID: NP_001074527
MGI: 1916812
Ensembl: ENSMUSG00000041297
UniProt: Q69ZA1
Position
13; 13 A2
AA seq 1511 aa AA seqDB search
MPSSSDTALGGGGGLSWAEKKLEERRKRRRFLSPQQPPLLLPLLQPQLLQPPPPPPPLLF
LAAPGAAAAAAAAAAASSSCFSPGPPLEVKRLARGKRRPGGRQKRRRGPRAGQEAEKRRV
FSLPQPQQDGGGGASSGGGVTPLVEYEDVSSQSEQGLLLGGASAATAATAAGGTGGNGGS
PASSSGTQRRAEGSERRPRRDRRSSSGRSKERHREHRRRDGTRSGSEASKARSRHGHSGE
ERAEAAKSGSSSSSGGRRKSASATSSSSSSRKDRDLKAHRSRTKSSKEPPSAYKEPPKAY
REDKSEPKAYRRRQRSLSPLGGRDESPVSHRASQSLRSRKSPSPAGGGSSPYSRRLPRSP
SPYSRRRSPSYSRHSSYERGGDVSPSPYSSSSWRRSRSPYSPVLRRSAKSRSRSPYSSRH
SRSRSRHRLSRSRSRHSSISPSTLTLKSSLAAELNKNKKARAAEAARAAEAAKAAEAAKA
AEAAAKAAKASNASTPTKGNTETGASVSQTNHVKEVKKLKTEHAPSPSSGGTVKSDKAKT
KPPLQVTKVDNNLTVEKATKKTVVGKESKPAATKEEPVSTKEKSKPLTPSTGAKEKEQHV
ALVTSTLPPLPLPPMLPEDKDADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDD
LSKSPEEKKTAAQLHSKRRPKICGPRYGEIKEKDIDWGKRCVDKFDIIGIIGEGTYGQVY
KARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALDF
KKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKC
SNILLNNRGQIKLADFGLARLYSSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSC
GCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKL
REEFVFIPAAALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHEL
WSKKRRRQKQMGMTDDLSTIKAPRKDLSLGLDDSRTNTPQGVLPPAQLKSQSNSNVAPVI
TGPGQPLNHSELAILLNLLQSKSSVNMADFVQVLNIKVNSETQQQLNKINLPAGILATGE
KQTDPSTPQQESSKSLGGVQPSQTIQPKVETDAAQAAVQSAFAVLLTQLIKAQQSKQKDA
MLEERENGSGHEAPLQLRPPLEPSTPGSGQDDLIQHQDRRILELTPEPDRPRILPPDQRP
PEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKAALLQLLAQHQPQDDPKREGGI
DYPTGDTYVPSSDYKDNFGSSFSAAPYVSSDGLGSSSAAAPLEARSFIGNSDIQSLDNYS
TASSHTGGPPQTSAFTESFASSVAGYGDIYLNAGPMLFSGDKDHRFEYSHGPITVLTNSN
DPSTGPESTHPLPAKMHNYNYGGNLQENPGGPSLMHGQTWTSPAQGPGYSQGYRGHISTS
AGRGRGRGLPY
NT seq 4536 nt NT seq  +upstreamnt  +downstreamnt
atgccgagtagctcggacacggcgctggggggaggcgggggcctgagctgggccgagaag
aagttggaggagcgccgcaagcggaggcgattcctgtcccctcagcagccgccgctgctg
ttgccgctcctgcagccgcagctcctgcaaccgccgccgcccccgccgcctctgctcttc
ctggctgcccccggcgcggccgccgccgcagccgccgccgccgcggcctcctcctcttgc
ttcagcccgggccctcctctggaggtcaagcggctggcgagaggcaagaggcgccccgga
gggcggcagaagcggcgccgcgggccccgcgccgggcaggaggcggagaagcgccgggtc
ttctcgctgccccagccgcagcaggacggcggtggcggtgccagtagcggcgggggtgtg
accccgctggtggagtacgaggatgtgagctcccagtccgagcaggggctgctgctgggg
ggcgccagcgcggcaacggcggcgacggctgccgggggaacggggggcaacggcgggagt
ccggcctcctcctccggcacgcagaggcgcgcggaggggtcggagcgcaggccgcgccgg
gaccgccgcagcagcagcggccgcagcaaggagcgccaccgcgagcaccggcggcgggac
gggacgcgcagcggcagcgaggcctcaaaggcccgcagccgccacggacacagcggcgag
gagcgggcggaggccgccaagagcggcagcagcagcagcagcggcggccgccgcaagagc
gcgtcggctacgtccagcagcagtagcagccgcaaggaccgggacctcaaggcccaccgc
agccggactaagtcgtccaaggaaccgccctcggcctacaaggagccgcccaaggcctac
cgggaggacaagagcgagccgaaggcctacaggcggcggcagcggtccctgagcccgctg
ggaggccgggacgaaagcccggtgtcccacagggcctcgcagagccttcggagccgcaag
tcccccagtccggcgggaggtggcagcagtccttattcccggcggctgccgcgctccccg
agcccctatagccggcgccgctcgcccagctacagccgccacagctcctacgagcggggc
ggcgacgtatcccccagcccgtacagcagcagcagctggcggcgctcgcgcagcccctac
agcccagtactcagacgatctgccaaatcccgaagcagaagcccatattcatctaggcac
tcaagatctcggagcaggcacagattgtctagatcaagaagtcgtcattcaagcatttct
cctagcacactaactctgaagagtagcttggcagctgaattgaacaagaataaaaaggca
cgagctgcagaggcagcaagagctgcagaggcagcaaaagctgcagaagctgctaaggct
gctgaagcagctgccaaagctgccaaagcctcaaatgcttctacacctaccaaggggaac
acagaaactggtgccagtgtctcacagacaaaccatgtgaaggaagtcaaaaaacttaaa
actgagcatgcaccttctccttcaagtggtgggaccgtcaaaagcgacaaagcaaaaaca
aagccaccgcttcaagtaacaaaggtagacaataatttgacagtagagaaagccaccaag
aaaacagttgttgggaaggagagtaaacctgctgctacaaaggaagaaccagtttccact
aaagagaaaagcaagccactcacaccaagcacaggagccaaggagaaggagcagcatgtg
gctttagtgacctctacgttaccgccattacctttgcctcccatgctgcctgaagataaa
gatgctgatagcttaagaggcaacatttctgtcaaagcagttaaaaaagaagtagaaaag
aaactccgatgtctgcttgctgatttaccattgccccctgagttaccaggaggagatgat
ctttccaagagtccagaggagaagaaaacagcagcacagttacatagcaaacgaaggcct
aaaatatgtgggcctcgctatggtgaaatcaaagaaaaagatattgactgggggaaacgc
tgcgtggataaatttgatatcatcggaattattggagaaggtacttatggacaagtttac
aaagccagggacaaagacacgggagaaatggtagccttaaagaaagtacgtctggataat
gaaaaggagggtttcccaattacagcaattagagaaattaaaattcttcggcaactcacc
caccagagtatcatcaatatgaaggaaatcgtgactgataaagaagatgctttggatttt
aagaaagacaaaggtgcattttacctggtgtttgaatatatggaccatgatctgatggga
ctgctggaatcaggcttggttcattttaatgaaaaccatataaaatcttttatgagacag
ctcatggaaggcctggattattgtcataagaagaactttttgcatagagatattaaatgt
tcaaatatccttctaaataatagaggacagataaaacttgcagattttggacttgctcgt
ttatatagctcagaagaaagtcgcccatatactaacaaggtcattactttgtggtatcgt
ccacctgaattgctcttgggagaagaacgatatacaccagccattgatgtatggagctgt
ggatgtatccttggtgaactcttcactaaaaaacctatatttcaagcaaaccaggaactt
gcacagctagagctaataagccgtatatgtgggagtccatgtcctgcagtgtggcctgat
gtaatcaaactgccatatttcaacaccatgaaaccaaagaagcaatatcggcggaagtta
agagaagaatttgttttcatccccgcagctgcactcgacttattcgattacatgcttgcc
ttggatcccagtaagcgctgcactgctgagcaggctcttcagtgtgagttcctgcgagac
gtggaaccctccaaaatgcctccaccagaccttcctttgtggcaagattgtcatgaatta
tggagtaaaaagagaagaagacagaaacagatgggcatgactgatgatctttccacaatc
aaagcccctaggaaggacctgtctctgggcttagatgacagcagaactaacacaccccag
ggtgtgctgccacccgcacagttgaaatctcagagcaactcaaatgtagcacctgtaata
acaggccctggacagccgttaaaccacagtgaattggcaattcttctaaacctactacaa
tctaaatcaagtgttaatatggctgattttgtccaagtgttgaacattaaggtaaactct
gagactcaacagcagctaaataaaataaaccttcctgctggaattttggcaacaggtgaa
aaacagacagatccatcaacaccacaacaggagtcttcaaaatcattgggaggagttcag
ccttcacagaccatccagcctaaagtggaaactgatgctgcccaggctgctgtgcagagt
gcatttgcagtcctcttgactcagttaataaaggcccaacagtccaaacagaaagatgcc
atgctagaggaaagggaaaatggatcaggacatgaagctccattgcaactcaggcctcct
ctagaaccgagcactcctggatccgggcaagatgacctcatccagcaccaagacaggagg
atattggagctgacaccagaaccagaccggcctcgaattctgcctcctgatcaacggcct
cctgaacctcctgaaccaccaccagttactgaggaggacctagattatcggacagaaaac
cagcatgttcctaccactagttcttcattaactgacccacatgctggagtgaaggcagcc
ctcttacagctgcttgctcagcatcagccccaggatgatcccaaaagagaaggtggtatc
gattatcccacaggagacacatatgtgcccagttcagactataaggacaactttggatct
tctttctctgccgctccttacgttagcagtgatggtctaggaagtagctccgctgctgca
ccattggaagcacgtagtttcattggaaactcagatattcagtctctggataactacagt
actgcttcatctcacactggtggtccacctcaaacttctgcctttactgagtcgtttgcc
agttcagtagctggatatggagacatttacctcaatgctggtcccatgttgtttagtgga
gacaaggaccatagatttgaatatagccatggtcctatcacagtcctcacaaacagcaat
gacccttccacagggccagagagtactcatcccttgccagcaaagatgcacaactataac
tatggtggtaacttacaggaaaatccaggtggccctagcctcatgcatggacagacctgg
acttctcctgcccaaggacctggatattcacaaggatacaggggacacattagcacatca
gctggcagaggtcgaggcagagggttaccatactga

DBGET integrated database retrieval system