KEGG   Mus musculus (house mouse): 69574
Entry
69574             CDS       T01002                                 
Symbol
Cmbl, 2310016A09Rik
Name
(RefSeq) carboxymethylenebutenolidase homolog
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu01100  Metabolic pathways
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     69574 (Cmbl)
SSDB
Motif
Pfam: DLH Abhydrolase_1 Peptidase_S9 FSH1 Abhydrolase_2 Hydrolase_4 Abhydrolase_5 BAAT_C Abhydrolase_6 Abhydrolase_3 DUF915 Abhydrolase_4 DUF829
Other DBs
NCBI-GeneID: 69574
NCBI-ProteinID: NP_853619
MGI: 1916824
Ensembl: ENSMUSG00000022235
UniProt: Q8R1G2
Position
15:31565314..31590266
AA seq 245 aa
MANEANPCPCDIGHKLEYGGMGHEVQVEHIKAYVTRSPVDAGKAVIVVQDIFGWQLPNTR
YMADMIARNGYTTIVPDFFVGQEPWDPAGDWSTFPAWLKSRNARKVNREVDAVLRYLRQQ
CHAQKIGIVGFCWGGVVVHQVMTAYPDIRAGVSVYGIIRDSEDVYNLKNPTLFIFAENDT
VIPLEQVSTLTQKLKEHCIVNYQVKTFSGQTHGFVHRKREDCSPADKPYIEEARRNLIEW
LNKYV
NT seq 738 nt   +upstreamnt  +downstreamnt
atggctaacgaagctaacccttgcccatgtgacattggtcacaaactagagtatggtggc
atgggccacgaagttcaggttgagcacatcaaggcatatgtcacccggtcccccgtggat
gcaggcaaagccgtgattgtcgtccaggatatatttggctggcagctgcccaacaccagg
tatatggctgacatgattgccagaaatggatacacaactattgtcccagacttctttgtg
ggtcaagagccatgggacccagctggtgactggtccaccttccccgcgtggttgaaatca
agaaatgccagaaaagtcaatcgggaggttgatgctgtcttgaggtatctgagacaacag
tgtcatgctcagaagattggcattgtgggcttctgctgggggggtgttgtggtgcaccaa
gtgatgacggcatacccggacatcagggcgggggtgtctgtctatggtatcatcagagat
tctgaagatgtttataatttgaagaacccaacgttgtttatttttgcagaaaatgacact
gtgattccacttgagcaggtttctacactgacccagaagcttaaagaacactgcatagtt
aattaccaagttaaaacgttttctgggcaaactcatggctttgtgcatcggaagagagaa
gactgctcccctgctgacaagccctacatcgaggaggcaaggaggaacctaattgaatgg
ctgaacaagtatgtctaa

DBGET integrated database retrieval system