KEGG   Mus musculus (mouse): 69577Help
Entry
69577             CDS       T01002                                 

Gene name
Fastkd3, 2310010B21Rik, AW048587
Definition
(RefSeq) FAST kinase domains 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: FAST_2 FAST_1 RAP
Motif
Other DBs
NCBI-GeneID: 69577
NCBI-ProteinID: NP_001317352
MGI: 1916827
Ensembl: ENSMUSG00000021532
UniProt: Q8BSN9
Position
13; 13 B3
AA seq 661 aa AA seqDB search
MAFITLRRAFCHKSILWIPGAVVALKIHPASHAPKAVTDRLSVCFCSLQPELFRVRFHHA
YCKNFHSEKGNDFHPVGEPWSSQAQEWNQPGQSLQNEDEEMLFRRLSYFTSFEEVLSFIS
ALDTLPVPLAMAALLRICEIGRRDGEQRLPEGVLENRAFQALCLRCERDPSHLTNAGLVT
ALQSLLTLLPADPQSSLMLSLVAECQRRLQRGNLEVHHLCVLGESLAMLQGASCETLKLV
VRQLQSKSVETFAPEEITSVYRILQVCPEEVDKHQMFLNTLNNFSISVVPYLSPKSISHV
LTALVALDQTHALPLLIKLGKYVVRYIPRFTNEELRKVLEAFVYFGHSDRFFTEALEQHV
SALCFSLDPAVASSVMGYCSRKRILSKPIFDVVSEIVVCQWDRLSPSQIAELIEPFGKLN
YVPPNAPALFRKVENVLCARLHHFPPKMLLRLLHSCALIERHPVNFMSKLFSPFFLQRLQ
GKESYLDRLSLAQLTQLFLTSVLECPFYKGPKLLPKYQVKSFLTPCCSLETPLDLHLYKS
VVIGLIDLLGSRLYFASKVLTPYYYTIDVEVKLDEDGFVLPCTVDEDIHKRVALCIDGPQ
RFCLDSKHLLGKEATKQRHLRLLGYQVVQLPYHELELLTSRLELVDYLQRKLFSQSSAVH
W
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcatcaccctgcggagggccttttgtcataagtccattctttggatacctgga
gctgtggttgctctgaaaattcaccctgccagtcatgccccaaaggcagtcacagatcgc
ctgagtgtgtgcttctgctccctacaacctgagctgttcagggtcagattccatcacgca
tactgtaaaaacttccactcagaaaagggaaatgactttcatcccgtgggcgagccatgg
tcctcccaggcgcaggaatggaaccagccaggacagagtcttcaaaacgaggatgaagag
atgcttttcaggagactaagctacttcacttcctttgaggaagtgctgagtttcataagt
gccctggacaccctgcctgtccctctggcaatggcagctctactcaggatctgtgagata
gggaggagggatggtgagcaaaggctgccagaaggagtgctggagaaccgtgccttccag
gctctttgcctccggtgtgagcgagacccctcacacctgaccaatgctggtttggtgaca
gctttgcaatctctgcttacgttgttgcctgcagatcctcaaagtagcctgatgctgagc
ctggtggcagaatgccaacgtcgtctccaaagaggcaacctcgaagtccaccatctttgt
gtccttggggaaagtctggccatgcttcaaggtgcgagttgtgagaccctgaagctggtt
gtccgtcaacttcaaagtaaaagtgtggaaacatttgctccagaggagatcacgtccgtt
tataggattctgcaggtgtgtcctgaagaagtagacaaacaccagatgttcttaaacaca
ttaaacaacttctccatttcagtagttccctacctgagccctaaatccattagccatgtc
ctcaccgccttagtggccctggaccagactcacgcactcccactgcttataaagctgggc
aagtacgttgtgagatacatcccccgttttaccaacgaagagctcaggaaggtcttggag
gcgtttgtctatttcggacacagtgacaggttcttcacagaggccttagagcaacatgtg
tccgccctgtgcttctccctggaccccgctgtggccagctccgtgatggggtactgcagc
aggaaacggattctctccaagcccatcttcgacgtagtctcagagatcgttgtttgccag
tgggacagactttcacctagtcagattgccgagctaattgagccatttggaaagctcaat
tacgtgccaccaaacgcccctgccctgtttaggaaggtagaaaatgtgctctgtgcccgt
ttacatcacttcccaccaaagatgctactgaggctccttcattcatgtgcgctgattgag
cgacatcccgtcaacttcatgtcaaaactattcagcccctttttccttcagcggctgcaa
ggtaaagagtcatatttggacagattgagcctggcacagctgacccaacttttcctaacc
tccgtcctagagtgtccgttctataagggccccaaacttcttcctaaatatcaagtgaag
tcatttctcactccatgctgctccttagagacgcccctggatctccatctgtataagtct
gtggtgattggactgattgatcttttaggatcaagactgtattttgcttcaaaggtgttg
acgccctattactacactatagatgttgaagttaaattagatgaagatggatttgtattg
ccgtgtacagtggatgaggatatccacaaaagggtggcgctgtgtattgatgggccacag
cgattttgcttggacagtaaacacttacttggaaaagaggctactaagcagagacacctg
cggttacttggttaccaggttgttcagcttccctatcatgagctggagctgcttacatca
agacttgagttggtggactatttacaaaggaagctgttttctcaaagctccgctgtccac
tggtaa

DBGET integrated database retrieval system